Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ATP13A4 shRNA (UAS) - Lentiviral human ATP13A4 shRNA (UAS, RFP) (25)
GTR15163151 1 Vial

Lentiviral human ATP13A4 shRNA (UAS) - Lentiviral human ATP13A4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Zfp672 (NM_178761) Mouse Tagged Lenti ORF Clone
MR207487L4 10 µg

Zfp672 (NM_178761) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RTDR1 Blocking Peptide
MBS9620422-01 1 mg

RTDR1 Blocking Peptide

Sign In for Pricing
View Details
RTDR1 Blocking Peptide
MBS9620422-02 5x 1 mg

RTDR1 Blocking Peptide

Sign In for Pricing
View Details
PCR Buffer I, NH4 Based
42-302 3x 1.5 mL/Unit

PCR Buffer I, NH4 Based

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Triiodothyronine (T3)
MBS2164318-01 0.1 mL

PE-Linked Monoclonal Antibody to Triiodothyronine (T3)

Sign In for Pricing
View Details