Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem27 AAV siRNA Pooled Vector
47034166 1.0 µg

Tmem27 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Calpain-9 (CAPN9) Rat ELISA Kit
C0770 96 Tests

Calpain-9 (CAPN9) Rat ELISA Kit

Sign In for Pricing
View Details
CDKN1A Knockout PATU8988T Polyclonal Cells
ARG11347 1 Million

CDKN1A Knockout PATU8988T Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral mouse Hes2 shRNA (UAS) - Lentiviral mouse Hes2 shRNA (UAS, iRFP) (100)
GTR15183675 1 Vial

Lentiviral mouse Hes2 shRNA (UAS) - Lentiviral mouse Hes2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-2682-5p Vector
mh31307 500 ng

LentimiRa-Off-hsa-miR-2682-5p Vector

Sign In for Pricing
View Details
PCDH-CMV-EHMT2EF1A-EGFP-T2A-PURO
BZ0671-2 1 Vial

PCDH-CMV-EHMT2EF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details