Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC16 Mouse Monoclonal Antibody [Clone ID: OTI3B6]
CF801281 100 µg

MUC16 Mouse Monoclonal Antibody [Clone ID: OTI3B6]

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 20 Antibody (10D8) [PerCP]
NBP2-42616PCP 100 µL

Mouse Monoclonal Cytokeratin 20 Antibody (10D8) [PerCP]

Sign In for Pricing
View Details
Lentiviral mouse Atp7a shRNA (UAS) - Lentiviral mouse Atp7a shRNA (UAS, iRFP) plasmid
GTR15192904 1 Vial

Lentiviral mouse Atp7a shRNA (UAS) - Lentiviral mouse Atp7a shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
LOC689425 siRNA Oligos set (Rat)
61313176 3x 5 nmol

LOC689425 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Rat FAM221B shRNA Plasmid
abx988922-01 150 µg

Rat FAM221B shRNA Plasmid

Sign In for Pricing
View Details
Rat FAM221B shRNA Plasmid
abx988922-02 300 µg

Rat FAM221B shRNA Plasmid

Sign In for Pricing
View Details