EDA2R/XEDAR, Mouse (HEK293, His)
The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html
Purity
98.0
Smiles
MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT
Molecular Formula
245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)
Molecular Weight
Approximately 26-29 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Desert Hedgehog Protein (DHH) Antibody (Biotin)
ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) (FITC)
ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) (FITC)