Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit
MBS7246480-01 48 Well

Bovine Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit

Sign In for Pricing
View Details
Bovine Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit
MBS7246480-02 96 Well

Bovine Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit

Sign In for Pricing
View Details
Bovine Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit
MBS7246480-03 5x 96 Well

Bovine Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit

Sign In for Pricing
View Details
Bovine Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit
MBS7246480-04 10x 96 Well

Bovine Cysteine-rich PAK1 inhibitor (CRIPAK) ELISA Kit

Sign In for Pricing
View Details
Anti-SEC24A Antibody
STJ502894 100 µg

Anti-SEC24A Antibody

Sign In for Pricing
View Details
HYKK siRNA (Mouse)
MBS8212058-01 15 nmol

HYKK siRNA (Mouse)

Sign In for Pricing
View Details