Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Narcissus pseudonarcissus Lectin (NPL/NPA) - Cy5
B2025195 1 mg

Narcissus pseudonarcissus Lectin (NPL/NPA) - Cy5

Sign In for Pricing
View Details
TCF-4 (T-cell Transcription Factor 4) (MaxLight 750) discontinued
T2026-ML750 100 µL

TCF-4 (T-cell Transcription Factor 4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit anti-SVG-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) ERG26 Polyclonal Antibody
MBS7160256 Inquire

Rabbit anti-SVG-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) ERG26 Polyclonal Antibody

Sign In for Pricing
View Details
TLR1 Peptide
MBS152276-01 0.05 mg

TLR1 Peptide

Sign In for Pricing
View Details
TLR1 Peptide
MBS152276-02 5x 0.05 mg

TLR1 Peptide

Sign In for Pricing
View Details
L-Threonine-15N
TRC-T405563-10MG 10 mg

L-Threonine-15N

Sign In for Pricing
View Details