Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEAL1 Mouse Monoclonal Antibody [Clone ID: OTI1D4]
CF807711 100 µg

TCEAL1 Mouse Monoclonal Antibody [Clone ID: OTI1D4]

Sign In for Pricing
View Details
NFATC2 Antibody
A51993-50UG 50 µg

NFATC2 Antibody

Sign In for Pricing
View Details
QuantumPlex™ - Carboxyl - 4.4µm - 5 populations
235B 1 mL - 20 Tests

QuantumPlex™ - Carboxyl - 4.4µm - 5 populations

Sign In for Pricing
View Details
Human TADA2B qPCR Primer Pair
QH58913S 200 Tests

Human TADA2B qPCR Primer Pair

Sign In for Pricing
View Details
Polyclonal Antibody to DLC1 (Ab-868)
35-1866-100 100 µL

Polyclonal Antibody to DLC1 (Ab-868)

Sign In for Pricing
View Details
Mouse Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1) Antibody Pair Kit (with Standard)
MBS2090352-01 5x 96 Tests

Mouse Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details