Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable transglycosylase isaA (isaA)

Product Specifications

Product Name Alternative

Immunodominant staphylococcal antigen A

Abbreviation

Recombinant Staphylococcus aureus isaA protein

Gene Name

IsaA

UniProt

P60157

Expression Region

30-233aa

Organism

Staphylococcus aureus (strain MW2)

Target Sequence

AEVNVDQAHLVDLAHNHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAANGQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSSNSNVEAVSAPTYHNYSTSTTSSSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQINAAVKAYKAQGLGAWGF

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Is able to cleave peptidoglycan.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.8 kDa

References & Citations

"Genome and virulence determinants of high virulence community-acquired MRSA." Baba T., Takeuchi F., Kuroda M., Yuzawa H., Aoki K., Oguchi A., Nagai Y., Iwama N., Asano K., Naimi T., Kuroda H., Cui L., Yamamoto K., Hiramatsu K. Lancet 359:1819-1827 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(E)-Acetylacrylic acid
TRC-A169435-500MG 500 mg

(E)-Acetylacrylic acid

Sign In for Pricing
View Details
FITC Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032C-01 50 Tests

FITC Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
FITC Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032C-02 100 Tests

FITC Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
FITC Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032C-03 2x 100 Tests

FITC Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
Human GPAM activation kit by CRISPRa
GA111677 1 Kit

Human GPAM activation kit by CRISPRa

Sign In for Pricing
View Details
(2E)-Pentene-1,5-diol
TRC-E230315-100MG 100 mg

(2E)-Pentene-1,5-diol

Sign In for Pricing
View Details