Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-14, Mouse (His)

Kallikrein-14 protein is a serine-type endopeptidase with multiple substrate specificities and has trypsin-like and chymotrypsin-like activities. It activates/inactivates protease-activated receptors (F2R, F2RL1, F2RL3) and other kallikreins (KLK1, KLK3, KLK5, KLK11) . Kallikrein-14 Protein, Mouse (His) is the recombinant mouse-derived Kallikrein-14 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-14 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-14-protein-mouse-his.html

Purity

92.00

Smiles

IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN

Molecular Formula

317653 (Gene_ID) Q8CGR5 (I24-N250) (Accession)

Molecular Weight

Approximately 28.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal to Human BRS3 / BRS-3
MBS240895-01 0.05 mg

Rabbit Polyclonal to Human BRS3 / BRS-3

Sign In for Pricing
View Details
Rabbit Polyclonal to Human BRS3 / BRS-3
MBS240895-02 5x 0.05 mg

Rabbit Polyclonal to Human BRS3 / BRS-3

Sign In for Pricing
View Details
SP100 Rabbit Polyclonal Antibody (HRP)
orb3111853 100 µg

SP100 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
5-acetyl-6-amino-1-benzylpyrimidine-2,4 (1H,3H) -dione
sc-350579 1 g

5-acetyl-6-amino-1-benzylpyrimidine-2,4 (1H,3H) -dione

Sign In for Pricing
View Details
CYP1A2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
17318111 3x 1.0 µg

CYP1A2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SH2D5 Antibody
orb194944-01 50 μL

SH2D5 Antibody

Sign In for Pricing
View Details