Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Pig (HEK293, Fc)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Pig (HEK293, Fc) is the recombinant pig-derived CD63 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Pig (HEK293, Fc), Pig, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-pig-hek293-fc.html

Purity

98.0

Smiles

RDKVKAEFNKDFQQQMQNYPKNNHTALILDRMQEDFKCCGAANYTDWEKILLSPKRVPDSCCVNVTQHCGVNFNVKEIHNEGCVEKIGSWLRSNVLV

Molecular Formula

100155929 (Gene_ID) XP_003355519.1 (R108-F204) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF1 Antibody
MBS8513756-01 0.1 mg

PHF1 Antibody

Sign In for Pricing
View Details
PHF1 Antibody
MBS8513756-02 0.1 mL (AF635)

PHF1 Antibody

Sign In for Pricing
View Details
PHF1 Antibody
MBS8513756-03 0.1 mL (AF610)

PHF1 Antibody

Sign In for Pricing
View Details
PHF1 Antibody
MBS8513756-04 0.1 mL (AF405S)

PHF1 Antibody

Sign In for Pricing
View Details
PHF1 Antibody
MBS8513756-05 0.1 mL (AF405L)

PHF1 Antibody

Sign In for Pricing
View Details
PHF1 Antibody
MBS8513756-06 0.1 mL (AF546)

PHF1 Antibody

Sign In for Pricing
View Details