Neuroserpin, Human (CHO)
Neuroserpin Protein, Human (CHO) is a member of the serpin family of serine protease inhibitors, playing an important role in synaptic plasticity and memory formation in the hippocampus.
Product Specifications
Product Name Alternative
Neuroserpin Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/neuroserpin-protein-human-cho.html
Purity
95.89
Smiles
TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Molecular Formula
5274 (Gene_ID) Q99574 (T17-L410) (Accession)
Molecular Weight
40-45 kDa
References & Citations
[1]Reumann R, et al. The serine protease inhibitor neuroserpin is required for normal synaptic plasticity and regulates learning and social behavior. Learn Mem. 2017 Nov 15;24 (12) :650-659.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940824-500 1x 500 µL
CD68 (LAMP4/824), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details