Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuroserpin, Human (CHO)

Neuroserpin Protein, Human (CHO) is a member of the serpin family of serine protease inhibitors, playing an important role in synaptic plasticity and memory formation in the hippocampus.

Product Specifications

Product Name Alternative

Neuroserpin Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuroserpin-protein-human-cho.html

Purity

95.89

Smiles

TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Molecular Formula

5274 (Gene_ID) Q99574 (T17-L410) (Accession)

Molecular Weight

40-45 kDa

References & Citations

[1]Reumann R, et al. The serine protease inhibitor neuroserpin is required for normal synaptic plasticity and regulates learning and social behavior. Learn Mem. 2017 Nov 15;24 (12) :650-659.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRM4 Antibody (OABF00860-100UL)
OABF00860-100UL 100 µL

GRM4 Antibody (OABF00860-100UL)

Sign In for Pricing
View Details
CASZ1
551629 50 µg

CASZ1

Sign In for Pricing
View Details
FLAD1 Antibody
E38QA4475 100 µL

FLAD1 Antibody

Sign In for Pricing
View Details
ADCY5 (Center) Rabbit pAb
MBS8557557-01 0.1 mL

ADCY5 (Center) Rabbit pAb

Sign In for Pricing
View Details
ADCY5 (Center) Rabbit pAb
MBS8557557-02 0.1 mL (AF405L)

ADCY5 (Center) Rabbit pAb

Sign In for Pricing
View Details
ADCY5 (Center) Rabbit pAb
MBS8557557-03 0.1 mL (AF405S)

ADCY5 (Center) Rabbit pAb

Sign In for Pricing
View Details