VSIG2, Human (HEK293, His)
VSIG2 is also known as CTXL (cortical thymocyte like-protein) . VSIG2 promotes malignant progression of pancreatic ductal adenocarcinoma through LAMtor2-mediated mTOR activation. VSIG2 can be used as a potential biomarker or therapeutic target for tumors. VSIG2 Protein, Human (HEK293, His) is the recombinant human-derived VSIG2 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
VSIG2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vsig2-protein-human-hek-293-his.html
Purity
99.90
Smiles
VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVA
Molecular Formula
23584 (Gene_ID) Q96IQ7-1 (V24-A243) (Accession)
Molecular Weight
29-35 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740029-100 1x 100 µL
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC051037-500 1x 500 µL
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472205-500 1x 500 µL
PGP9.5 / UchL1 (pan-Neuronal Marker) (rUCHL1/775), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682884-500 1x 500 µL
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0040-500 1x 500 µL
CD35 / CR1 (E11), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details