Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG2, Human (HEK293, His)

VSIG2 is also known as CTXL (cortical thymocyte like-protein) . VSIG2 promotes malignant progression of pancreatic ductal adenocarcinoma through LAMtor2-mediated mTOR activation. VSIG2 can be used as a potential biomarker or therapeutic target for tumors. VSIG2 Protein, Human (HEK293, His) is the recombinant human-derived VSIG2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VSIG2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig2-protein-human-hek-293-his.html

Purity

99.90

Smiles

VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVA

Molecular Formula

23584 (Gene_ID) Q96IQ7-1 (V24-A243) (Accession)

Molecular Weight

29-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Boydii trmJ Protein (aa 1-246)
VAng-Lsx09411-50gEcoli 50 µg (E. coli)

Recombinant Shigella Boydii trmJ Protein (aa 1-246)

Sign In for Pricing
View Details
POLA2 293 Cell Lysate
408972 0.1 mg

POLA2 293 Cell Lysate

Sign In for Pricing
View Details
IRF1 Rabbit Polyclonal Antibody (Biotin)
orb2120977 100 µL

IRF1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
DFNA5 shRNA Plasmid (m)
sc-77136-SH 20 µg

DFNA5 shRNA Plasmid (m)

Sign In for Pricing
View Details
Recombinant Glucosidase Alpha, Acid (GaA)
SIPA331Mu01-01 10 µg

Recombinant Glucosidase Alpha, Acid (GaA)

Sign In for Pricing
View Details
Recombinant Glucosidase Alpha, Acid (GaA)
SIPA331Mu01-02 50 µg

Recombinant Glucosidase Alpha, Acid (GaA)

Sign In for Pricing
View Details