Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fragile X mental retardation 1 neighbor protein (FMR1NB), partial

Product Specifications

Product Name Alternative

Cancer/testis antigen 37 (CT37) (Sarcoma antigen NY-SAR-35)

Abbreviation

Recombinant Human FMR1NB protein, partial

Gene Name

FMR1NB

UniProt

Q8N0W7

Expression Region

90-183aa

Organism

Homo sapiens (Human)

Target Sequence

LCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.4 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Stathmin 1 Antibody (STMN1/8012) [DyLight 488]
NBP3-26960G 0.1 mL

Mouse Monoclonal Stathmin 1 Antibody (STMN1/8012) [DyLight 488]

Sign In for Pricing
View Details
TFAP2D sgRNA CRISPR Lentivector set (Human)
K2361301 3x 1.0 µg

TFAP2D sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CYFIP1 Protein Vector (Human) (pPB-N-His)
PV011426 500 ng

CYFIP1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
FCER1A Human 201 a.a
32-13227-50 50 µg

FCER1A Human 201 a.a

Sign In for Pricing
View Details
C6orf66 ORF Vector (Human) (pORF)
ORF001686 1.0 µg DNA

C6orf66 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Pre-Mrna-Splicing Regulator WTAP (WTAP) Antibody
abx456117-01 50 µg

Pre-Mrna-Splicing Regulator WTAP (WTAP) Antibody

Sign In for Pricing
View Details