Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBI, Human (His)

DBI, a versatile protein, binds medium- and long-chain acyl-CoA esters, indicating a potential intracellular carrier role. It also displaces diazepam from the benzodiazepine recognition site on the GABA type A receptor. This dual functionality suggests DBI may act as a neuropeptide, modulating GABA receptor activity. Remarkably, DBI functions as a monomer in these interactions. DBI Protein, Human (His) is the recombinant human-derived DBI protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

DBI Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dbi-protein-human-his.html

Purity

95.0

Smiles

WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Molecular Formula

1622 (Gene_ID) P07108-2 (W2-I104) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human PCDHB1 shRNA (UAS) - Lentiviral human PCDHB1 shRNA (UAS, iRFP) plasmid
GTR15329359 1 Vial

Lentiviral human PCDHB1 shRNA (UAS) - Lentiviral human PCDHB1 shRNA (UAS, iRFP) plasmid

Ask
View Details
Lentiviral mouse Acss1 shRNA (UAS) - Lentiviral mouse Acss1 shRNA (UAS, GFP) (100)
GTR15172233 1 Vial

Lentiviral mouse Acss1 shRNA (UAS) - Lentiviral mouse Acss1 shRNA (UAS, GFP) (100)

Ask
View Details
Lentiviral mouse Acsf2 shRNA (UAS) - Lentiviral mouse Acsf2 shRNA (UAS, RFP) (25)
GTR15206039 1 Vial

Lentiviral mouse Acsf2 shRNA (UAS) - Lentiviral mouse Acsf2 shRNA (UAS, RFP) (25)

Ask
View Details
Recombinant Anti-MNX1 Rabbit mAb
CMA4235-01 30 µL

Recombinant Anti-MNX1 Rabbit mAb

Ask
View Details
Recombinant Anti-MNX1 Rabbit mAb
CMA4235-02 50 μL

Recombinant Anti-MNX1 Rabbit mAb

Ask
View Details
Recombinant Anti-MNX1 Rabbit mAb
CMA4235-03 100 µL

Recombinant Anti-MNX1 Rabbit mAb

Ask
View Details