Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBI, Human (His)

DBI, a versatile protein, binds medium- and long-chain acyl-CoA esters, indicating a potential intracellular carrier role. It also displaces diazepam from the benzodiazepine recognition site on the GABA type A receptor. This dual functionality suggests DBI may act as a neuropeptide, modulating GABA receptor activity. Remarkably, DBI functions as a monomer in these interactions. DBI Protein, Human (His) is the recombinant human-derived DBI protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

DBI Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dbi-protein-human-his.html

Purity

95.0

Smiles

WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Molecular Formula

1622 (Gene_ID) P07108-2 (W2-I104) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL4D shRNA Plasmid (m)
sc-141243-SH 20 µg

ARL4D shRNA Plasmid (m)

Sign In for Pricing
View Details
Mouse Monoclonal Perilipin-2/ADFP Antibody (ADFP/1365) [Alexa Fluor 700]
NBP2-54369AF700 100 µL

Mouse Monoclonal Perilipin-2/ADFP Antibody (ADFP/1365) [Alexa Fluor 700]

Sign In for Pricing
View Details
IL-3/IL-5/GM-CSFRβ (1C1) Alexa Fluor® 488
sc-21765 AF488 200 µg/mL

IL-3/IL-5/GM-CSFRβ (1C1) Alexa Fluor® 488

Sign In for Pricing
View Details
ZNF48-set siRNA/shRNA/RNAi Lentivector (Human)
51549091 4x 500 ng

ZNF48-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Apoc2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4843404 1.0 µg DNA

Apoc2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
4-Hydroxybenzoic Acid-d4
TRC-H808452-100MG 100 mg

4-Hydroxybenzoic Acid-d4

Sign In for Pricing
View Details