Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBI, Human (His)

DBI, a versatile protein, binds medium- and long-chain acyl-CoA esters, indicating a potential intracellular carrier role. It also displaces diazepam from the benzodiazepine recognition site on the GABA type A receptor. This dual functionality suggests DBI may act as a neuropeptide, modulating GABA receptor activity. Remarkably, DBI functions as a monomer in these interactions. DBI Protein, Human (His) is the recombinant human-derived DBI protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

DBI Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dbi-protein-human-his.html

Purity

95.0

Smiles

WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Molecular Formula

1622 (Gene_ID) P07108-2 (W2-I104) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K7 antibody
MBS5301499-01 0.05 mL

MAP3K7 antibody

Sign In for Pricing
View Details
MAP3K7 antibody
MBS5301499-02 5x 0.05 mL

MAP3K7 antibody

Sign In for Pricing
View Details
Zinc propionate
sc-280202 50 g

Zinc propionate

Sign In for Pricing
View Details
PAK2 Antibody
MBS7124106-01 0.05 mL

PAK2 Antibody

Sign In for Pricing
View Details
PAK2 Antibody
MBS7124106-02 0.1 mL

PAK2 Antibody

Sign In for Pricing
View Details
PAK2 Antibody
MBS7124106-03 5x 0.1 mL

PAK2 Antibody

Sign In for Pricing
View Details