Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBI, Human (His)

DBI, a versatile protein, binds medium- and long-chain acyl-CoA esters, indicating a potential intracellular carrier role. It also displaces diazepam from the benzodiazepine recognition site on the GABA type A receptor. This dual functionality suggests DBI may act as a neuropeptide, modulating GABA receptor activity. Remarkably, DBI functions as a monomer in these interactions. DBI Protein, Human (His) is the recombinant human-derived DBI protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

DBI Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dbi-protein-human-his.html

Purity

95.0

Smiles

WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Molecular Formula

1622 (Gene_ID) P07108-2 (W2-I104) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Mouse mLKL pAb
PA14176-01 50 μL

Rabbit Anti-Mouse mLKL pAb

Sign In for Pricing
View Details
Rabbit Anti-Mouse mLKL pAb
PA14176-02 100 μL

Rabbit Anti-Mouse mLKL pAb

Sign In for Pricing
View Details
FBXO24 siRNA (h)
sc-89896 10 µM

FBXO24 siRNA (h)

Sign In for Pricing
View Details
March11 CRISPR All-in-one AAV vector set (with saCas9)(Human)
28096151 3x 1.0 µg DNA

March11 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
SCML4 Rabbit pAb, PerCP-Cy7 conjugated
orb2864520 100 µL

SCML4 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Caprazol
MBS5824431 Inquire

Caprazol

Sign In for Pricing
View Details