Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Group XIIA secretory phospholipase A2 (PLA2G12A)

Product Specifications

CAS Number

9000-83-3

Gene Name

PLA2G12A

UniProt

Q9BZM1

Expression Region

23-189aa

Organism

Homo sapiens

Target Sequence

QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Field of Research

Cardiovascular

Assay Type

Developed Protein

Relevance

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.6 kDa

References & Citations

"Cloning and recombinant expression of human group IIF-secreted phospholipase A (2)." Valentin E., Singer A.G., Ghomashchi F., Lazdunski M., Gelb M.H., Lambeau G. Biochem. Biophys. Res. Commun. 279:223-228 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-500 1x 500 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
BNC880181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), CF594 conjugate, 0.1mg/mL
BNC940417-100 1x 100 µL

Fascin-1 (FSCN1/417), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2579), CF488A conjugate, 0.1mg/mL
BNC882579-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2579), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/2208R), CF647 conjugate, 0.1mg/mL
BNC472208-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/2208R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calpain 1 (CAPN1/1530), CF647 conjugate, 0.1mg/mL
BNC471530-100 1x 100 µL

Calpain 1 (CAPN1/1530), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details