Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI2, Mouse (HEK293, hFc)

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor.It has a weak effect on factor Xa and has no effect on thrombin.Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1.TFPI2 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TFPI2 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi2-protein-mouse-hek293-hfc.html

Purity

95.0

Smiles

LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWKKPKRWKIGDFLPRFWKHLS

Molecular Formula

21789 (Gene_ID) O35536 (L23-S230) (Accession)

Molecular Weight

55-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP2B1 Rabbit Monoclonal Antibody [Clone ID: R02-8C5]
TA421670 100 µL

ATP2B1 Rabbit Monoclonal Antibody [Clone ID: R02-8C5]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB510124 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
2,2'-Binaphthalene-6,6'-dicarboxylic Acid
TRC-B386900-5MG 5 mg

2,2'-Binaphthalene-6,6'-dicarboxylic Acid

Sign In for Pricing
View Details
Phosphoric Acid Tributyl Ester
TRC-P359445-5G 5 g

Phosphoric Acid Tributyl Ester

Sign In for Pricing
View Details
Mouse Col6a2 activation kit by CRISPRa
GA200822 1 Kit

Mouse Col6a2 activation kit by CRISPRa

Sign In for Pricing
View Details
Indoline
TRC-I627200-5G 5 g

Indoline

Sign In for Pricing
View Details