Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI2, Mouse (HEK293, hFc)

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor.It has a weak effect on factor Xa and has no effect on thrombin.Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1.TFPI2 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TFPI2 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi2-protein-mouse-hek293-hfc.html

Purity

95.0

Smiles

LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWKKPKRWKIGDFLPRFWKHLS

Molecular Formula

21789 (Gene_ID) O35536 (L23-S230) (Accession)

Molecular Weight

55-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-100 1x 100 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-100 1x 100 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-100 1x 100 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-500 1x 500 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details