Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin, Human (N-His, C-Myc)

Galanin exists as an endocrine hormone in the central and peripheral nervous systems and exerts its effects by binding to and activating G protein-coupled receptors (i.e., GALR1, GALR2, and GALR3) . Galanin Protein, Human (N-His, C-Myc) is the recombinant human-derived Galanin protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Galanin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galanin-protein-human-n-his-c-myc.html

Purity

98

Smiles

GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

Molecular Formula

51083 (Gene_ID) P22466 (G44-S123) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL8RA Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV810343 1.0 µg DNA

IL8RA Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
RHCG Rabbit Polyclonal Antibody
TA380904 100 µL

RHCG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCDC71 CRISPRa sgRNA lentivector (set of three targets)(Human)
15299121 3x 1.0µg DNA

CCDC71 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
ApoA4 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-2688R-BF555-TR 20 µL

ApoA4 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]
TA501899 100 µL

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]

Sign In for Pricing
View Details
ASGR1 Recombinant Protein (Rat)
RP191186 100 µg

ASGR1 Recombinant Protein (Rat)

Sign In for Pricing
View Details