Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 15 (Gdf15)

Product Specifications

Product Name Alternative

GDF-15; Macrophage inhibitory cytokine 1; MIC-1

Abbreviation

Recombinant Mouse Gdf15 protein

Gene Name

Gdf15

UniProt

Q9Z0J7

Expression Region

189-303aa

Organism

Mus musculus (Mouse)

Target Sequence

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Tag

N-terminal hFC-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor, GFRAL, and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which constitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions. On hepatocytes, inhibits growth hormone signaling.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAX Rabbit Polyclonal Antibody (PerCP)
orb2497461 100 µL

TRAX Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Cathepsin B (CTSB) Human qPCR Template Standard (NM_147781)
HK211837 1 Kit

Cathepsin B (CTSB) Human qPCR Template Standard (NM_147781)

Sign In for Pricing
View Details
DAB1 Polyclonal Antibody
MBS2572827-01 0.06 mL

DAB1 Polyclonal Antibody

Sign In for Pricing
View Details
DAB1 Polyclonal Antibody
MBS2572827-02 0.12 mL

DAB1 Polyclonal Antibody

Sign In for Pricing
View Details
DAB1 Polyclonal Antibody
MBS2572827-03 0.2 mL

DAB1 Polyclonal Antibody

Sign In for Pricing
View Details
DAB1 Polyclonal Antibody
MBS2572827-04 5x 0.2 mL

DAB1 Polyclonal Antibody

Sign In for Pricing
View Details