Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD81, Mouse (HEK293, His)

The CD81 protein has important effects on cellular processes and is involved in CD19 receptor trafficking on activated B cells. This facilitates CD19-CR2 and B cell receptor complex assembly, lowering the antigen dose threshold for B cell clonal expansion. CD81 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD81 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd81-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK

Molecular Formula

12520 (Gene_ID) P35762 (K116-K201) (Accession)

Molecular Weight

Approximately 10 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rps6ka5 (Ribosomal Protein S6 Kinase alpha-5, S6K-alpha-5, 90kD Ribosomal Protein S6 Kinase 5, Nuclear Mitogen- and Stress-Activated Protein Kinase 1, RSK-like Protein Kinase, RLSK, Rps6ka5, Msk1) (FITC) discontinued
302719-FITC 200 µL

Rps6ka5 (Ribosomal Protein S6 Kinase alpha-5, S6K-alpha-5, 90kD Ribosomal Protein S6 Kinase 5, Nuclear Mitogen- and Stress-Activated Protein Kinase 1, RSK-like Protein Kinase, RLSK, Rps6ka5, Msk1) (FITC) discontinued

Ask
View Details
HIF1AN Antibody
A76468-100UL 100 µL

HIF1AN Antibody

Ask
View Details
Anti-Immunoglobulin A (IGA) Polyclonal antibody
FY-AB33215-01 1 mL

Anti-Immunoglobulin A (IGA) Polyclonal antibody

Ask
View Details
Anti-Immunoglobulin A (IGA) Polyclonal antibody
FY-AB33215-02 100 µL

Anti-Immunoglobulin A (IGA) Polyclonal antibody

Ask
View Details
Anti-Immunoglobulin A (IGA) Polyclonal antibody
FY-AB33215-03 200 µL

Anti-Immunoglobulin A (IGA) Polyclonal antibody

Ask
View Details
NKTR Recombinant, Human, aa10-175, His-SUMO-Tag (NK-tumor Recognition Protein)
374426-01 20 µg

NKTR Recombinant, Human, aa10-175, His-SUMO-Tag (NK-tumor Recognition Protein)

Ask
View Details