Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD81, Mouse (HEK293, His)

The CD81 protein has important effects on cellular processes and is involved in CD19 receptor trafficking on activated B cells. This facilitates CD19-CR2 and B cell receptor complex assembly, lowering the antigen dose threshold for B cell clonal expansion. CD81 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD81 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd81-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK

Molecular Formula

12520 (Gene_ID) P35762 (K116-K201) (Accession)

Molecular Weight

Approximately 10 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Glycerol, 99.5%, Ph. Eur., USP, Ultrapure
GC5551-1l 1 L

Glycerol, 99.5%, Ph. Eur., USP, Ultrapure

Ask
View Details
ZNF259P CRISPR All-in-one AAV vector set (with saCas9)(Human)
69179151 3x 1.0 µg DNA

ZNF259P CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
RCHY1 (RING Finger and CHY Zinc Finger Domain-containing Protein 1, Androgen Receptor N-terminal-interacting Protein, CH-rich-interacting Match with PLAG1, E3 Ubiquitin-protein Ligase Pirh2, RING Finger Protein 199, Zinc Finger Protein 363, p53-induced RING-H2 Protein, hPirh2, ARNIP, CHIMP, PIRH2, RNF199, ZNF363) (PE)
132434-PE 100 µL

RCHY1 (RING Finger and CHY Zinc Finger Domain-containing Protein 1, Androgen Receptor N-terminal-interacting Protein, CH-rich-interacting Match with PLAG1, E3 Ubiquitin-protein Ligase Pirh2, RING Finger Protein 199, Zinc Finger Protein 363, p53-induced RING-H2 Protein, hPirh2, ARNIP, CHIMP, PIRH2, RNF199, ZNF363) (PE)

Ask
View Details
N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) Antibody
abx019243 1 mg

N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) Antibody

Ask
View Details