CD81, Mouse (HEK293, His)
The CD81 protein has important effects on cellular processes and is involved in CD19 receptor trafficking on activated B cells. This facilitates CD19-CR2 and B cell receptor complex assembly, lowering the antigen dose threshold for B cell clonal expansion. CD81 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.
Product Specifications
Product Name Alternative
CD81 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd81-protein-mouse-hek293-his.html
Purity
98.0
Smiles
KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK
Molecular Formula
12520 (Gene_ID) P35762 (K116-K201) (Accession)
Molecular Weight
Approximately 10 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Nuclear Respiratory Factor 1 (NRF1) Magnetic Fluorescence Assay Kit
Nuclear Respiratory Factor 1 (NRF1) Magnetic Fluorescence Assay Kit
Nuclear Respiratory Factor 1 (NRF1) Magnetic Fluorescence Assay Kit
Lentiviral human PRXL2C shRNA (UAS) - Lentiviral human PRXL2C shRNA (UAS, GFP) (100)