Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD81, Mouse (HEK293, His)

The CD81 protein has important effects on cellular processes and is involved in CD19 receptor trafficking on activated B cells. This facilitates CD19-CR2 and B cell receptor complex assembly, lowering the antigen dose threshold for B cell clonal expansion. CD81 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD81 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd81-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK

Molecular Formula

12520 (Gene_ID) P35762 (K116-K201) (Accession)

Molecular Weight

Approximately 10 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-100 1x 100 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-500 1x 500 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details