Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIG/CXCL9, Human (His)

MIG, also known as CXCL9 protein, occurs as a cytokine that affects the growth, movement, or activation state of cells involved in immune and inflammatory responses. Specifically, it acts as a potent chemoattractant for activated T cells, coordinating their migration. Animal-Free MIG/CXCL9 Protein, Human (His) is the recombinant human-derived animal-FreeMIG/CXCL9 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIG/CXCL9 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mig-cxcl9-protein-human-his.html

Purity

95.0

Smiles

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Molecular Formula

4283 (Gene_ID) Q07325 (T23-T125) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lingo4 (NM_177250) Mouse Untagged Clone
MC219775 10 µg

Lingo4 (NM_177250) Mouse Untagged Clone

Sign In for Pricing
View Details
3'-Dephospho-Palmitoyl-CoA
NU-1180S 20 µL

3'-Dephospho-Palmitoyl-CoA

Sign In for Pricing
View Details
Clonixin 50mg
A17502-50 50 mg

Clonixin 50mg

Sign In for Pricing
View Details
Fmoc-N-propyl-hydroxylamine
278107 1 g

Fmoc-N-propyl-hydroxylamine

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Dihydroxy-acid dehydratase (ilvD)
MBS1110910-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O45:K1 Dihydroxy-acid dehydratase (ilvD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Dihydroxy-acid dehydratase (ilvD)
MBS1110910-02 0.02 mg (Yeast)

Recombinant Escherichia coli O45:K1 Dihydroxy-acid dehydratase (ilvD)

Sign In for Pricing
View Details