What is the catalog number for FGF-9, Mouse (His)?

The catalog number for FGF-9, Mouse (His) is HY-P7352A.

What sizes are available for FGF-9, Mouse (His)?

FGF-9, Mouse (His) is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg.

How many pack sizes does FGF-9, Mouse (His) come in?

FGF-9, Mouse (His) is available in 4 different pack sizes.

Is FGF-9, Mouse (His) in stock?

FGF-9, Mouse (His) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures FGF-9, Mouse (His)?

FGF-9, Mouse (His) is manufactured by QuantiMol.

What is the estimated delivery time for FGF-9, Mouse (His)?

Estimated delivery time for FGF-9, Mouse (His) is approximately 15 business day(s), depending on your location.

FGF-9, Mouse (His)

FGF-9 is a member of mouse heparin-binding fibroblast growth factors located on the outside of cell membranes. FGF-9 is a regulator of chondrogenesis and vascularization during bone development. FGF-9 binds to fibroblast growth factor receptors (FGFRs) to activate downstream signaling pathways, such as PI3K-AKT, RAS-MAPK and protein kinase C (PKC) pathways. FGF-9 regulates embryonic development, cell proliferation, cell differentiation and cell migration. FGF-9 plays an important role in differentiation, survival of neuronal cells and growth stimulation of glial tumors. FGF-9 Protein, Mouse (His) is a recombinant protein with a N-His label and is produced in E. coli[1][2][3][4][5].

Product Specifications

Product Name Alternative

FGF-9 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

Protein Tyrosine Kinase/RTK

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-mouse-n-his.html

Purity

98.0

Smiles

APLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

14180 (Gene_ID) P54130 (A2-S208) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Patzek S, et al. Loss of Fgf9 in mice leads to pancreatic hypoplasia and asplenia. iScience. 2023 Mar 25;26 (4) :106500. |[2]Pan YN, et al. Fibroblast growth factor 9 reduces TBHP-induced oxidative stress in chondrocytes and diminishes mouse osteoarthritis by activating ERK/Nrf2 signaling pathway. Int Immunopharmacol. 2023 Jan;114:109606.|[3]Li A, et al. Fibroblast growth factor 9 attenuates sepsis-induced fulminant hepatitis in mice. Amino Acids. 2022 Jul;54 (7) :1069-1081.|[4]Li R, Sun Y, et al. The Fibroblast Growth Factor 9 (Fgf9) Participates in Palatogenesis by Promoting Palatal Growth and Elevation. Front Physiol. 2021 Apr 20;12:653040.|[5]Ganji E, et al. Targeted deletion of Fgf9 in tendon disrupts mineralization of the developing enthesis. FASEB J. 2023 Mar;37 (3) :e22777. doi: 10.1096/fj.202201614R. Erratum in: FASEB J. 2023 Apr;37 (4) :e22856.