Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VISTA/B7-H5, Mouse (HEK293, Fc)

VISTA/B7-H5 Protein is a type I transmembrane protein expressed primarily in white blood cells that inhibits T cell function. VISTA/B7-H5 Protein promotes embryonic stem cell differentiation by inhibiting BMP4 signaling and stimulates MMP14 mediated MMP2 activation. VISTA/B7-H5 Protein is highly expressed in tumors. VISTA/B7-H5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived VISTA/B7-H5 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VISTA/B7-H5 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vista-b7-h5-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALA

Molecular Formula

74048 (Gene_ID) Q9D659 (F33-A194) (Accession)

Molecular Weight

60-68 kDa

References & Citations

[1]Sakr MA, et al. GI24 enhances tumor invasiveness by regulating cell surface membrane-type 1 matrix metalloproteinase. Cancer Sci. 2010 Nov;101 (11) :2368-74.|[2]Lines JL, et al. VISTA is an immune checkpoint molecule for human T cells. Cancer Res. 2014 Apr 1;74 (7) :1924-32.|[3]Yoon KW, et al. Control of signaling-mediated clearance of apoptotic cells by the tumor suppressor p53. Science. 2015 Jul 31;349 (6247) :1261669.|[4]Le Mercier I, et al. VISTA Regulates the Development of Protective Antitumor Immunity. Cancer Res. 2014 Apr 1;74 (7) :1933-44.|[5]Kondo Y, et al. Differential contribution of three immune checkpoint (VISTA, CTLA-4, PD-1) pathways to antitumor responses against squamous cell carcinoma. Oral Oncol. 2016 Jun;57:54-60.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c Abl (ABL1) Rabbit Polyclonal Antibody
AP14452PU-N 400 µL

c Abl (ABL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GM CSF Receptor alpha (CSF2RA) (NM_172247) Human Recombinant Protein
TP320607L 1 mg

GM CSF Receptor alpha (CSF2RA) (NM_172247) Human Recombinant Protein

Sign In for Pricing
View Details
Protein C (PROC) (NM_000312) Human Over-expression Lysate
LC400117 20 µg

Protein C (PROC) (NM_000312) Human Over-expression Lysate

Sign In for Pricing
View Details
Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), Biotin conjugate, 0.1mg/mL
BNCB2983-500 1x 500 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GDAP1L1 activation kit by CRISPRa
GA112298 1 Kit

Human GDAP1L1 activation kit by CRISPRa

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/2092R), Biotin conjugate, 0.1mg/mL
BNCB2092-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/2092R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details