Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mucin-1/MUC1, Human (120a.a, HEK293, His)

Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (120a.a, HEK293, His) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Mucin-1/MUC1 Protein, Human (120a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mucin-1-muc1-protein-human-120a-a-hek293-his.html

Purity

91.00

Smiles

LSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAG

Molecular Formula

4582 (Gene_ID) P15941-1 (L1036-G1155) (Accession)

Molecular Weight

14-16 kDa, and 7-8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse IL-4 Antibody[11B11]
E-AB-F1204UE-01 25 µg

APC Anti-Mouse IL-4 Antibody[11B11]

Sign In for Pricing
View Details
APC Anti-Mouse IL-4 Antibody[11B11]
E-AB-F1204UE-02 100 µg

APC Anti-Mouse IL-4 Antibody[11B11]

Sign In for Pricing
View Details
Mouse Olfr17 activation kit by CRISPRa
GA203017 1 Kit

Mouse Olfr17 activation kit by CRISPRa

Sign In for Pricing
View Details
CYP11B1 (NM_001026213) Human Over-expression Lysate
LY422463 100 µg

CYP11B1 (NM_001026213) Human Over-expression Lysate

Sign In for Pricing
View Details
Glucose 6-Phosphate Isomerase (CPTC-GPI-1), CF594 conjugate, 0.1mg/mL
BNC942257-100 1x 100 µL

Glucose 6-Phosphate Isomerase (CPTC-GPI-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PCIF1 activation kit by CRISPRa
GA111927 1 Kit

Human PCIF1 activation kit by CRISPRa

Sign In for Pricing
View Details