Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12)

Product Specifications

Product Name Alternative

Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12

Abbreviation

Recombinant Mouse Gng12 protein

Gene Name

Gng12

UniProt

Q9DAS9

Expression Region

2-69aa

Organism

Mus musculus (Mouse)

Target Sequence

SSKTASTNSIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSENPFKDKKTC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.0 kDa

References & Citations

"Disruption of G-protein gamma5 subtype causes embryonic lethality in mice." Moon A.M., Stauffer A.M., Schwindinger W.F., Sheridan K., Firment A., Robishaw J.D. PLoS One 9:e90970-e90970 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF740 conjugate, 0.1mg/mL
BNC742207-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF640R conjugate, 0.1mg/mL
BNC401564-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2819R), CF740 conjugate, 0.1mg/mL
BNC742819-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2819R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), 0.2mg/mL
BNUB0324-500 1x 500 µL

CD53 (161-2), 0.2mg/mL

Sign In for Pricing
View Details