Carbonic Anhydrase 10, Human (His)
Carbonic Anhydrase 10 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 10 is an inactive isoform of carbonic anhydrase (CAs) [1].
Product Specifications
Product Name Alternative
Carbonic Anhydrase 10 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/carbonic-anhydrase-10-protein-human-his.html
Smiles
AQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNHHHHHH
Molecular Formula
56934 (Gene_ID) Q9NS85-1 (A21-N300) (Accession)
Molecular Weight
Approximately 31 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Ashok Aspatwar, et al. An update on carbonic anhydrase-related proteins VIII, X and XI. J Enzyme Inhib Med Chem. 2013 Dec;28 (6) :1129-42.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9919441 Inquire
Goose Meiotic Recombination Protein DMC1/LIM15 Homolog (DMC1) ELISA Kit
Sign In for Pricing
View Details K0017503 1.0 µg DNA
ABCA10 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 
MBS7091142 Inquire
Recombinant Anthoceros formosae Photosystem I P700 chlorophyll a apoprotein A1 (psaA), partial
Sign In for Pricing
View Details