Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Mouse (HEK293)

The immunoglobulin heavy chain constant region is the heavy chain constant region of immunoglobulin. Sequence differences between immunoglobulin heavy chains leads to the various isotypes with different characteristic[1][2]. IgG1 Protein, Mouse (HEK293) is the recombinant mouse-derived IgG1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG1 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ighg1-protein-mouse-hek-293.html

Purity

96.35

Smiles

PRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK

Molecular Formula

/ (Gene_ID) AAK53870.1 (P99-K324) (Accession)

Molecular Weight

Approximately 30-33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD18 / Integrin beta2 subunit Monoclonal Antibody (Clone:MEM-148)
30-1218-0.1 0.1 mg

Anti-CD18 / Integrin beta2 subunit Monoclonal Antibody (Clone:MEM-148)

Sign In for Pricing
View Details
(D-Phe5, Cys6,11, N-Me-D-Trp8) -Somatostatin-14 (5-12) amide
T76612-01 5 mg

(D-Phe5, Cys6,11, N-Me-D-Trp8) -Somatostatin-14 (5-12) amide

Sign In for Pricing
View Details
(D-Phe5, Cys6,11, N-Me-D-Trp8) -Somatostatin-14 (5-12) amide
T76612-02 50 mg

(D-Phe5, Cys6,11, N-Me-D-Trp8) -Somatostatin-14 (5-12) amide

Sign In for Pricing
View Details
NDRG4 shRNA Plasmid (h)
sc-93374-SH 20 µg

NDRG4 shRNA Plasmid (h)

Sign In for Pricing
View Details
4- (4-Chloro-phenyl) -1- (4-fluoro-phenyl) -1H-imidazole-2-thiol
sc-347975A 5 g

4- (4-Chloro-phenyl) -1- (4-fluoro-phenyl) -1H-imidazole-2-thiol

Sign In for Pricing
View Details
AMP Activated Protein Kinase alpha1 (AMPKa1) (AP) (Drosophila)
MBS6247384-01 0.1 mL

AMP Activated Protein Kinase alpha1 (AMPKa1) (AP) (Drosophila)

Sign In for Pricing
View Details