IgG1, Mouse (HEK293)
The immunoglobulin heavy chain constant region is the heavy chain constant region of immunoglobulin. Sequence differences between immunoglobulin heavy chains leads to the various isotypes with different characteristic[1][2]. IgG1 Protein, Mouse (HEK293) is the recombinant mouse-derived IgG1 protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
IgG1 Protein, Mouse (HEK293), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ighg1-protein-mouse-hek-293.html
Purity
96.35
Smiles
PRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Molecular Formula
/ (Gene_ID) AAK53870.1 (P99-K324) (Accession)
Molecular Weight
Approximately 30-33 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2077046-01 0.1 mL
PE-Linked Monoclonal Antibody to Peptidyl Arginine Deiminase Type III (PADI3)
Sign In for Pricing
View Details MBS2077046-02 0.2 mL
PE-Linked Monoclonal Antibody to Peptidyl Arginine Deiminase Type III (PADI3)
Sign In for Pricing
View Details MBS2077046-03 0.5 mL
PE-Linked Monoclonal Antibody to Peptidyl Arginine Deiminase Type III (PADI3)
Sign In for Pricing
View Details