Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Fimbrial adhesin PapGI (papGI)

Product Specifications

Abbreviation

Recombinant E.coli papGI protein

Gene Name

PapGI

UniProt

P13720

Expression Region

22-335aa

Organism

Escherichia coli

Target Sequence

GWHNVMFYAFNDYLTTNAGNVKVIDQPQLYIPWNTGSATATYYSCSGPEFASGVYFQEYLAWMVVPKHVYTNEGFNIFLDVQSKYGWSMENENDKDFYFFVNGYEWDTWTNNGARICFYPGNMKQLNNKFNDLVFRVLLPVDLPKGHYNFPVRYIRGIQHHYYDLWQDHYKMPYDQIKQLPATNTLMLSFDNVGGCQPSTQVLNIDHGSIVIDRANGNIASQTLSIYCDVPVSVKISLLRNTPPIYNNNKFSVGLGNGWDSIISLDGVEQSEEILRWYTAGSKTVKIESRLYGEEGKRKPGELSGSMTMVLSFP

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Tip adhesin component of type P pili that binds preferentially to host cell glycosphingolipids such as globotriaosylceramide.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0781408 1.0 µg DNA

FH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to T-Cell Activation Rho GTPase Activating Protein (TAGAP)
MBS2142253-01 0.1 mL

FITC-Linked Polyclonal Antibody to T-Cell Activation Rho GTPase Activating Protein (TAGAP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to T-Cell Activation Rho GTPase Activating Protein (TAGAP)
MBS2142253-02 0.2 mL

FITC-Linked Polyclonal Antibody to T-Cell Activation Rho GTPase Activating Protein (TAGAP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to T-Cell Activation Rho GTPase Activating Protein (TAGAP)
MBS2142253-03 0.5 mL

FITC-Linked Polyclonal Antibody to T-Cell Activation Rho GTPase Activating Protein (TAGAP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to T-Cell Activation Rho GTPase Activating Protein (TAGAP)
MBS2142253-04 1 mL

FITC-Linked Polyclonal Antibody to T-Cell Activation Rho GTPase Activating Protein (TAGAP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to T-Cell Activation Rho GTPase Activating Protein (TAGAP)
MBS2142253-05 5 mL

FITC-Linked Polyclonal Antibody to T-Cell Activation Rho GTPase Activating Protein (TAGAP)

Sign In for Pricing
View Details