Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tau (K18) Delta K280 Mutant Pre-formed Fibrils

Human Recombinant Tau (K18) Delta K280 Mutant PFFs

Product Specifications

Background

Alzheimer’s Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1) . It was named after Alois Alzheimer, a German scientist who discovered tangled bundles of fibrils where neurons had once been in the brain of a deceased patient in 1907 (2) . Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing hyperphosphorylated tau fibrils (3) . The ΔK280 mutation is associated with frontotemporal dementia and promotes fibrillization into paired helical filaments (PHFs) in the absence of heparin and other inducers (4) . K18 is a truncated form of human tau containing only the 4 microtubule binding repeats (5) .

Product Name Alternative

Tau PFFs, Tau PFF, Tau protein Pre-formed Fibrils, Tau aggregates, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 4, tubulin-associated unit, MAPT DeltaK280, ΔK280 Tau, K18 delta K280 Tau, truncated ΔK280 Tau

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Gene ID

4137

Swiss Prot

P10636

Cellular Locus

Cytoplasm | Axolemma | Axolemma Plasma Membrane | Axon | Cell Body | Cell membrane | Cytoplasmic Ribonucleoprotein Granule | Cytoplasmic Side | Cytoskeleton | Cytosol | Dendrite | Growth cone | Microtubule | Microtubule Associated Complex | Neurofibrillary Tangle | Neuronal Cell Body | Nuclear Periphery | Nuclear Speck | Nucleus | Peripheral membrane protein | Plasma Membrane | Tubulin Complex

Expression System

E. coli

Host

E. coli

Origin Species

Human

Target

Tau (K18) Delta K280 Mutant

Conjugation

No Tag

Nature

Recombinant

Sequence

MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE

Applications

WB | SDS-PAGE | In vivo assay | In vitro assay

Field of Research

Alzheimer's Disease | Axon Markers | Cell Markers | Cell Signaling | Cytoskeleton | Microtubules | MT Associated Proteins | Neurodegeneration | Neuron Markers | Neuroscience | Tangles & Tau

Purification Method

Ion-exchange Purified

Purification

Ion-exchange Purified

Limit Of Detection

Certified >95% pure using SDS-PAGE analysis. Low endotoxin <5 EU/mL @ 2mg/mL.

Concentration

2 mg/ml

Purity

>95%

Weight

0.5

Length

Partial

Buffer

PBS pH 7.4

Molecular Weight

~15 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Additionnal Information

For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-476.

References & Citations

1. www.alz.org/alzheimers-dementia/facts-figures 2. Alzheimer, A. Über eine eigenartige Erkrankung der Hirnrinde. Allg. Z. Psychiatr. Psych.-Gerichtl. Med. 64, 146–148 (1907) 3. Matsumoto, G. et al. (2018). Int J Mol Sci. 19, 1497. 4.Von Bergen, M. et al. (2001). J Biol Chem. 276(51):48165-48174. 5. Guo, J. and Lee, M.Y. (2013). FEBS Lett. 587(6): 717-723.

Shipping Conditions

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

Storage Conditions

-80ºC

Notes

For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-476.

Protein Length

Partial

Background Reference 01

1. www.alz.org/alzheimers-dementia/facts-figures 2. Alzheimer, A. Über eine eigenartige Erkrankung der Hirnrinde. Allg. Z. Psychiatr. Psych.-Gerichtl. Med. 64, 146–148 (1907) 3. Matsumoto, G. et al. (2018) . Int J Mol Sci. 19, 1497. 4.Von Bergen, M. et al. (2001) . J Biol Chem. 276 (51) :48165-48174. 5. Guo, J. and Lee, M.Y. (2013) . FEBS Lett. 587 (6) : 717-723.

Location

Cytoplasm | Axolemma | Axolemma Plasma Membrane | Axon | Cell Body | Cell membrane | Cytoplasmic Ribonucleoprotein Granule | Cytoplasmic Side | Cytoskeleton | Cytosol | Dendrite | Growth cone | Microtubule | Microtubule Associated Complex | Neurofibrillary Tangle | Neuronal Cell Body | Nuclear Periphery | Nuclear Speck | Nucleus | Peripheral membrane protein | Plasma Membrane | Tubulin Complex

AA Sequence

MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE

Immunogen Species

Human

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Apoptotic Peptidase Activating Factor 1 ELISA Kit
MBS723922-01 48 Strip Well (Competitive)

Human Apoptotic Peptidase Activating Factor 1 ELISA Kit

Ask
View Details
Human Apoptotic Peptidase Activating Factor 1 ELISA Kit
MBS723922-02 48 Strip Well (Sandwich)

Human Apoptotic Peptidase Activating Factor 1 ELISA Kit

Ask
View Details
Human Apoptotic Peptidase Activating Factor 1 ELISA Kit
MBS723922-03 96 Strip Well (Competitive)

Human Apoptotic Peptidase Activating Factor 1 ELISA Kit

Ask
View Details
Human Apoptotic Peptidase Activating Factor 1 ELISA Kit
MBS723922-04 96 Strip Well (Sandwich)

Human Apoptotic Peptidase Activating Factor 1 ELISA Kit

Ask
View Details
Human Apoptotic Peptidase Activating Factor 1 ELISA Kit
MBS723922-05 5x 96 Strip Well (Competitive)

Human Apoptotic Peptidase Activating Factor 1 ELISA Kit

Ask
View Details
Human Apoptotic Peptidase Activating Factor 1 ELISA Kit
MBS723922-06 5x 96 Strip Well (Sandwich)

Human Apoptotic Peptidase Activating Factor 1 ELISA Kit

Ask
View Details