Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP90 Protein

P. Falciparum Recombinant HSP90 Partial Protein

Product Specifications

Background

HSP90 is a highly conserved and abundantly expressed molecular chaperone that exists in two major cytosolic isoforms: HSP90α and HSP90β. It is essential for the folding, stabilization, and functional regulation of a wide array of client proteins, many of which are involved in signal transduction, cell cycle control, and stress responses. In the nervous system, HSP90 plays a critical role in maintaining proteostasis, particularly under conditions of cellular stress. It forms dynamic complexes with co-chaperones such as CDC37, p23, and immunophilins, which guide the maturation and stabilization of client proteins. This function is especially relevant in neurodegenerative diseases, where protein misfolding and aggregation are central pathological features. HSP90 has been shown to interact with key neurodegenerative disease-related proteins, including tau, α-synuclein, and huntingtin. While it can stabilize these proteins and prevent aggregation, it may also inadvertently preserve toxic conformers. As such, HSP90 is a double-edged sword in neurodegeneration—both protective and potentially pathogenic. Pharmacological inhibition of HSP90 has emerged as a therapeutic strategy to promote the degradation of misfolded proteins and restore cellular homeostasis. Its high expression in neurons and involvement in multiple neurodegenerative pathways make HSP90 a compelling target for therapeutic intervention and biomarker development.

Product Name Alternative

HSP90, HSP90AB1, HSP90-beta, HSPCB, HSPC2, Heat shock protein HSP 90-beta, Heat shock 84 kDa protein, HSP84, HSP90B

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Gene ID

811999

Swiss Prot

Q8IL32

Accession Number

XP_001348591.1

Cellular Locus

Cytoplasm | Melanosome

Expression System

E. coli

Host

E. coli

Origin Species

P. falciparum

Target

HSP90

Conjugation

No tag

Nature

Recombinant

Sequence

QPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQIFDVASMQGGYTIDDTGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNELQSEMKSTNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDVNKINLGENDVSQNTMHKQDSGLFNLDPSILNSNMLSGSDKTLL

Applications

WB | SDS-PAGE

Field of Research

Cancer | Heat Shock | Cell Signaling | Protein Trafficking | Chaperone Proteins | Cancer | Tumor Biomarkers

Purification Method

Affinity Purified

Purification

Affinity Purified

Limit Of Detection

This product has been certified >90% pure using SDS-PAGE analysis.

Concentration

Lot/batch specific. See included datasheet.

Purity

>90%

Weight

0.05

Length

Partial

Buffer

50mM Tris/HCl pH7.5, 300mM NaCl, 10% glycerol

Molecular Weight

~21.4 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

References & Citations

1. Nemoto T., et al. (1997) J.Biol Chem. 272: 26179-26187. 2. Minami Y., et al. (1991) J.Biol Chem. 266: 10099-10103. 3. Arlander S.J.H, et al. (2003) J Biol Chem. 278: 52572-52577. 4. Pearl H., et al. (2001) Adv Protein Chem. 59: 157-186. 5. Neckers L., et al. (2002) Trends Mol Med. 8: S55-S61. 6. Pratt W., Toft D. (2003) Exp Biol Med. 228: 111-133. 7. Pratt W., Toft D. (1997) Endocr Rev. 18: 306–360. 8. Pratt W.B. (1998) Proc Soc Exptl Biol Med. 217: 420–434. 9. Whitesell L., et al. (1994) Proc Natl Acad Sci USA. 91: 8324–8328. 10. Banumathy G., Singh V., Pavithra S.R., and Tatu U. (2003) J Biol Chem. 278(20): 18336-45. 11. Pavithra S.R, Banumathy G., Joy O., Singh V., and Tatu U. (2004) J Biol Chem. 279(45): 46692-9.

Shipping Conditions

Blue Ice or 4ºC

Storage Conditions

-20ºC

Protein Length

Partial

Background Reference 01

1. Nemoto T., et al. (1997) J.Biol Chem. 272: 26179-26187. 2. Minami Y., et al. (1991) J.Biol Chem. 266: 10099-10103. 3. Arlander S.J.H, et al. (2003) J Biol Chem. 278: 52572-52577. 4. Pearl H., et al. (2001) Adv Protein Chem. 59: 157-186. 5. Neckers L., et al. (2002) Trends Mol Med. 8: S55-S61. 6. Pratt W., Toft D. (2003) Exp Biol Med. 228: 111-133. 7. Pratt W., Toft D. (1997) Endocr Rev. 18: 306–360. 8. Pratt W.B. (1998) Proc Soc Exptl Biol Med. 217: 420–434. 9. Whitesell L., et al. (1994) Proc Natl Acad Sci USA. 91: 8324–8328. 10. Banumathy G., Singh V., Pavithra S.R., and Tatu U. (2003) J Biol Chem. 278 (20) : 18336-45. 11. Pavithra S.R, Banumathy G., Joy O., Singh V., and Tatu U. (2004) J Biol Chem. 279 (45) : 46692-9.

Location

Cytoplasm | Melanosome

AA Sequence

QPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQIFDVASMQGGYTIDDTGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNELQSEMKSTNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDVNKINLGENDVSQNTMHKQDSGLFNLDPSILNSNMLSGSDKTLL

Immunogen Species

P. falciparum

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Prmt1 siRNA Oligos set (Mouse)
37714174 3x 5 nmol

Prmt1 siRNA Oligos set (Mouse)

Ask
View Details
Human ABCB4 qPCR Primer Pair
QH20009S 200 Tests

Human ABCB4 qPCR Primer Pair

Ask
View Details
Yipf7 Mouse siRNA Oligo Duplex (Locus ID 75581)
SR407178 1 Kit

Yipf7 Mouse siRNA Oligo Duplex (Locus ID 75581)

Ask
View Details
Rabbit Anti-Human PRKCA Monoclonal Antibody, Clone S16-5F6
DMAB-JX2362009 20 µL, 50 µL, 100 µL

Rabbit Anti-Human PRKCA Monoclonal Antibody, Clone S16-5F6

Ask
View Details
Estrogen Receptor (ER) (BSA & Azide Free) (MaxLight 490) discontinued
E3564-75X-ML490 100 µL

Estrogen Receptor (ER) (BSA & Azide Free) (MaxLight 490) discontinued

Ask
View Details