Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab5 Protein

Human Recombinant Rab5 Protein

Product Specifications

Background

Rab5 is a small GTPase of the Ras superfamily that plays a central role in regulating early endocytic trafficking. It cycles between an inactive GDP-bound state and an active GTP-bound state, a process tightly controlled by regulatory proteins such as GEFs, GAPs, and GDIs. In its active form, Rab5 associates with early endosomal membranes, where it recruits effector proteins like EEA1 and Rabaptin-5 to mediate vesicle docking, fusion, and cargo sorting. In neuroscience, Rab5 is essential for maintaining synaptic function and neuronal homeostasis through its regulation of receptor internalization, endosome maturation, and axonal transport. Dysregulation of Rab5 activity has been linked to impaired endosomal trafficking, a hallmark of several neurodegenerative diseases including Alzheimer’s and Parkinson’s. In Alzheimer’s disease, for example, Rab5 overactivation is associated with enlarged early endosomes and disrupted amyloid precursor protein (APP) processing, contributing to amyloid-beta accumulation. Rab5 also plays a role in neurotrophin signaling and synaptic plasticity, making it a key player in both neuronal development and degeneration. Its localization to early endosomes and the plasma membrane makes Rab5 a valuable marker for studying endocytic dysfunction in neurodegenerative models.

Product Name Alternative

Rab5, Rab5A, Ras-related protein Rab-5A, RAS associated protein RAB5A, RAB5A member RAS oncogene family

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Gene ID

5868

Swiss Prot

P20339

Accession Number

BC001267

Cellular Locus

Cell Membrane | Early Endosome Membrane | Melanosome

Expression System

E. coli

Host

E. coli

Origin Species

Human

Target

Rab5

Conjugation

His tag

Nature

Recombinant

Sequence

MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN

Applications

WB | SDS-PAGE

Field of Research

Cancer | Heat Shock

Purification Method

Affinity Purified

Purification

Affinity Purified

Limit Of Detection

This product has been certified >90% pure using SDS-PAGE analysis.

Concentration

Lot/batch specific. See included datasheet.

Purity

>90%

Weight

0.1

Buffer

20mM Tris/HCl, pH7.5, 0.15M NaCl

Molecular Weight

~26 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

References & Citations

1. Stenmark H., and Olkkonen V.M. (2001) Genome Biol. 2: 3007.1-3007.7. 2. Takai Y., et al. (2001) Physiol. Rev. 8:, 153-208. 3. Ali B.R., et al. (2004) J. Cell Sci. 117: 6401-6412. 4. Zerial M., and McBride H. (2001) Nat. Rev. Mol. Cell Biol. 2: 107-117. 5. Sonnichsen B., et al. (2000) J. Cell Biol. 149: 901-913 6. Woodman P.G. (2000) Traffic. 1: 695-701.

Shipping Conditions

Blue Ice or 4ºC

Storage Conditions

-20ºC

Background Reference 01

1. Stenmark H., and Olkkonen V.M. (2001) Genome Biol. 2: 3007.1-3007.7. 2. Takai Y., et al. (2001) Physiol. Rev. 8:, 153-208. 3. Ali B.R., et al. (2004) J. Cell Sci. 117: 6401-6412. 4. Zerial M., and McBride H. (2001) Nat. Rev. Mol. Cell Biol. 2: 107-117. 5. Sonnichsen B., et al. (2000) J. Cell Biol. 149: 901-913 6. Woodman P.G. (2000) Traffic. 1: 695-701.

Location

Cell Membrane | Early Endosome Membrane | Melanosome

AA Sequence

MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN

Immunogen Species

Human

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2R,5S)-7-Oxo-6-(sulfooxy)-1,6-diazabicyclo[3.2.1]octane-2-carboxamide Monosodium Salt
TRC-O249490-25MG 25 mg

(2R,5S)-7-Oxo-6-(sulfooxy)-1,6-diazabicyclo[3.2.1]octane-2-carboxamide Monosodium Salt

Sign In for Pricing
View Details
Guinea pig FGF4 (Fibroblast Growth Factor 4) ELISA Kit
MBS2511811-01 24 Tests

Guinea pig FGF4 (Fibroblast Growth Factor 4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig FGF4 (Fibroblast Growth Factor 4) ELISA Kit
MBS2511811-02 48 Tests

Guinea pig FGF4 (Fibroblast Growth Factor 4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig FGF4 (Fibroblast Growth Factor 4) ELISA Kit
MBS2511811-03 96 Tests

Guinea pig FGF4 (Fibroblast Growth Factor 4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig FGF4 (Fibroblast Growth Factor 4) ELISA Kit
MBS2511811-04 5x 96 Tests

Guinea pig FGF4 (Fibroblast Growth Factor 4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig FGF4 (Fibroblast Growth Factor 4) ELISA Kit
MBS2511811-05 10x 96 Tests

Guinea pig FGF4 (Fibroblast Growth Factor 4) ELISA Kit

Sign In for Pricing
View Details