Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial

Product Specifications

Product Name Alternative

PTH/PTHrP type I receptor; PTH/PTHr receptor; Parathyroid hormone 1 receptor; PTH1 receptor

Abbreviation

Recombinant Dog PTH1R protein, partial

Gene Name

PTH1R

UniProt

Q9TU31

Expression Region

27-188aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

DADDVMTKEEQIFLLHRAQAQCQKRLKEVLQRPADIMESDKGWASASTSGKPKKEKASGKLYPESEEDKEVPTGSRHRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

A cytochrome P450 monooxygenase involved in the biosynthesis of adrenal corticoids. Catalyzes the hydroxylation of carbon hydrogen bond at 11-beta position of 11-deoxycortisol and 11-deoxycorticosterone/21-hydroxyprogesterone yielding cortisol or corticosterone, respectively. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate and reducing the second into a water molecule. Two electrons are provided by NADPH via a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur protein FDX1 or FDX2 (adrenodoxin/ferredoxin) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNMT3B Antibody, mAb, Rabbit
A02417-100 100 µL

DNMT3B Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Kansl1 Mouse qPCR Primer Pair (NM_001081045)
MP213274 200 Reactions

Kansl1 Mouse qPCR Primer Pair (NM_001081045)

Sign In for Pricing
View Details
Cry2 Antibody [AMM22252G]
AMM22252G-01 50 µL

Cry2 Antibody [AMM22252G]

Sign In for Pricing
View Details
Cry2 Antibody [AMM22252G]
AMM22252G-02 100 µL

Cry2 Antibody [AMM22252G]

Sign In for Pricing
View Details
Cry2 Antibody [AMM22252G]
AMM22252G-03 200 µL

Cry2 Antibody [AMM22252G]

Sign In for Pricing
View Details
Cry2 Antibody [AMM22252G]
AMM22252G-04 400 µL

Cry2 Antibody [AMM22252G]

Sign In for Pricing
View Details