Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-10 (IL10)

Product Specifications

Product Name Alternative

Cytokine synthesis inhibitory factor ; CSIF

Abbreviation

Recombinant Human IL10 protein

Gene Name

IL10

UniProt

P22301

Expression Region

19-178aa

Organism

Homo sapiens (Human)

Target Sequence

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Molecular Weight

45.6 kDa

References & Citations

A Gly15Arg mutation in the interleukin-10 gene reduces secretion of interleukin-10 in Crohn disease.van der Linde K., Boor P.P., Sandkuijl L.A., Meijssen M.A., Savelkoul H.F., Wilson J.H., de Rooij F.W.Scand. J. Gastroenterol. 38:611-617 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DEFB1/ Beta-defensin 1 Protein, Untagged, E.coli-25ug
QP10429-ec-25ug 25ug

Recombinant Human DEFB1/ Beta-defensin 1 Protein, Untagged, E.coli-25ug

Sign In for Pricing
View Details
Fuca2 sgRNA CRISPR Lentivector set (Rat)
K7409801 3x 1.0 µg

Fuca2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal 58K Golgi Protein Antibody (FTCD/357) [Janelia Fluor 549]
NBP3-14274JF549 0.1 mL

Mouse Monoclonal 58K Golgi Protein Antibody (FTCD/357) [Janelia Fluor 549]

Sign In for Pricing
View Details
Cripto-1, CR-1
M41912-01 100 mg

Cripto-1, CR-1

Sign In for Pricing
View Details
Cripto-1, CR-1
M41912-02 25 mg

Cripto-1, CR-1

Sign In for Pricing
View Details
Cripto-1, CR-1
M41912-03 50 mg

Cripto-1, CR-1

Sign In for Pricing
View Details