Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Erythropoietin, Rat (sf9, His)

Epo protein is a hormone that plays a vital role in regulating red blood cell production in the body.It stimulates the differentiation and maturation of red blood cells in the bone marrow.Erythropoietin Protein, Rat (sf9, His) is the recombinant rat-derived Erythropoietin protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

Erythropoietin Protein, Rat (sf9, His), Rat, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/erythropoietin-protein-rat-sf9-his.html

Smiles

MGVPERPTLLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Molecular Formula

24335 (Gene_ID) P29676-1 (A27-R192) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-100 1x 100 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-500 1x 500 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DE-K18), CF594 conjugate, 0.1mg/mL
BNC940563-100 1x 100 µL

Cytokeratin 18 (DE-K18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details