Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM5, Human (N-His)

GSTM5 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles, crucial for cellular detoxification. Its enzymatic activity, addressing both exogenous and endogenous compounds, is essential for eliminating harmful substances and maintaining cellular homeostasis, highlighting GSTM5's protective role against toxic insults. GSTM5 Protein, Human (N-His) is the recombinant human-derived GSTM5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GSTM5 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gstm5-protein-human-his.html

Purity

98.0

Smiles

MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK

Molecular Formula

2949 (Gene_ID) P46439 (M1-K218) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Deformyl-N-benzyloxycarbonyl Orlistat
TRC-D229050-50MG 50 mg

N-Deformyl-N-benzyloxycarbonyl Orlistat

Sign In for Pricing
View Details
Transmembrane Protease, Serine 3 (TMPRSS3) Antibody
abx219022 100 µg

Transmembrane Protease, Serine 3 (TMPRSS3) Antibody

Sign In for Pricing
View Details
Monkey anti gliadin antibody (IgA) ELISA Kit
GTR10356516 96 Well

Monkey anti gliadin antibody (IgA) ELISA Kit

Sign In for Pricing
View Details
Olfr1205 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
32666154 3x 1.0 µg DNA

Olfr1205 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
N-alpha-Fmoc-Nim-trityl-L-histidine 4-alkoxybenzyl alcohol resin
276898-01 2 g

N-alpha-Fmoc-Nim-trityl-L-histidine 4-alkoxybenzyl alcohol resin

Sign In for Pricing
View Details
N-alpha-Fmoc-Nim-trityl-L-histidine 4-alkoxybenzyl alcohol resin
276898-02 5 g

N-alpha-Fmoc-Nim-trityl-L-histidine 4-alkoxybenzyl alcohol resin

Sign In for Pricing
View Details