Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-5195-3p miRNA Mimic
CMH1778-01 5 nmol

Hsa-miR-5195-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-5195-3p miRNA Mimic
CMH1778-02 10 nmol

Hsa-miR-5195-3p miRNA Mimic

Sign In for Pricing
View Details
Trp53i11 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4601302 1.0 µg DNA

Trp53i11 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
TRNAT12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV754182 1.0 µg DNA

TRNAT12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
BI-7273 (Standard)
HY-100351R 1 Each

BI-7273 (Standard)

Sign In for Pricing
View Details
P2rx6 ORF Vector (Rat) (pORF)
ORF073022 1.0 µg DNA

P2rx6 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details