Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Diablo Homolog (DIABLO) Protein
abx653172-01 10 µg

Rat Diablo Homolog (DIABLO) Protein

Sign In for Pricing
View Details
Rat Diablo Homolog (DIABLO) Protein
abx653172-02 50 µg

Rat Diablo Homolog (DIABLO) Protein

Sign In for Pricing
View Details
Rat Diablo Homolog (DIABLO) Protein
abx653172-03 100 µg

Rat Diablo Homolog (DIABLO) Protein

Sign In for Pricing
View Details
Rat Diablo Homolog (DIABLO) Protein
abx653172-04 200 µg

Rat Diablo Homolog (DIABLO) Protein

Sign In for Pricing
View Details
Rat Diablo Homolog (DIABLO) Protein
abx653172-05 500 µg

Rat Diablo Homolog (DIABLO) Protein

Sign In for Pricing
View Details
IL18RAP (Interleukin-18 Receptor Accessory Protein, IL-18 Receptor Accessory Protein, IL-18RAcP, Accessory Protein-like, AcPL, CD218 Antigen-like Family Member B, CDw218b, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7)
320271-01 50 µL

IL18RAP (Interleukin-18 Receptor Accessory Protein, IL-18 Receptor Accessory Protein, IL-18RAcP, Accessory Protein-like, AcPL, CD218 Antigen-like Family Member B, CDw218b, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7)

Sign In for Pricing
View Details