Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GSTA4 Antibody (OTI3F5) [PerCP]
NBP2-70856PCP 0.1 mL

Mouse Monoclonal GSTA4 Antibody (OTI3F5) [PerCP]

Sign In for Pricing
View Details
CD38 antibody (Spectral Red)
MBS532196-01 0.1 mg

CD38 antibody (Spectral Red)

Sign In for Pricing
View Details
CD38 antibody (Spectral Red)
MBS532196-02 5x 0.1 mg

CD38 antibody (Spectral Red)

Sign In for Pricing
View Details
HNRNPA1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0976102 1.0 µg DNA

HNRNPA1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Monoclonal CD48 Antibody (monoclonal) (M01), Clone: 3B8-2C2
AMM03346G 0.1mg

Monoclonal CD48 Antibody (monoclonal) (M01), Clone: 3B8-2C2

Sign In for Pricing
View Details
LEF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV679087 1.0 µg DNA

LEF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details