Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDSUB1 3'UTR Lenti-reporter-Luc Vector
50391081 1.0 µg

WDSUB1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
S100A5 (Protein S100-A5, Protein S-100D, S100 Calcium-binding Protein A5, S100D) (PE)
132924-PE 100 µL

S100A5 (Protein S100-A5, Protein S-100D, S100 Calcium-binding Protein A5, S100D) (PE)

Sign In for Pricing
View Details
Mt4 sgRNA CRISPR Lentivector set (Rat)
K6131001 3x 1.0 µg

Mt4 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
CD209 sgRNA CRISPR Lentivector (Human) (Target 3)
K0406704 1.0 µg DNA

CD209 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Alpha Internexin Recombinant Antibody, PE Conjugated
bsm-54173R-PE-01 20 µL

Alpha Internexin Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Alpha Internexin Recombinant Antibody, PE Conjugated
bsm-54173R-PE-02 100 µL

Alpha Internexin Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details