Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP3 sgRNA CRISPR Lentivector set (Human)
K2672801 3x 1.0 µg

ZFP3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
EPHA4 Conjugated Antibody
MBS9447296-01 0.1 mL (Biotin)

EPHA4 Conjugated Antibody

Sign In for Pricing
View Details
EPHA4 Conjugated Antibody
MBS9447296-02 0.1 mL (AF350)

EPHA4 Conjugated Antibody

Sign In for Pricing
View Details
EPHA4 Conjugated Antibody
MBS9447296-03 0.1 mL (AF405)

EPHA4 Conjugated Antibody

Sign In for Pricing
View Details
EPHA4 Conjugated Antibody
MBS9447296-04 0.1 mL (AF488)

EPHA4 Conjugated Antibody

Sign In for Pricing
View Details
EPHA4 Conjugated Antibody
MBS9447296-05 0.1 mL (AF555)

EPHA4 Conjugated Antibody

Sign In for Pricing
View Details