Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bin1 Blocking Peptide
33R-10869 50 ug

Bin1 Blocking Peptide

Sign In for Pricing
View Details
Rac threo-Dihydrobupropion (threo-Hydroxybupropion)
D3570-27 10 mg

Rac threo-Dihydrobupropion (threo-Hydroxybupropion)

Sign In for Pricing
View Details
Anti-ICAM-1 (CD54) Antibody
MBS4158871-01 0.1 mg

Anti-ICAM-1 (CD54) Antibody

Sign In for Pricing
View Details
Anti-ICAM-1 (CD54) Antibody
MBS4158871-02 5x 0.1 mg

Anti-ICAM-1 (CD54) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal MOX1 Antibody (OTI5B11) [Alexa Fluor 532]
NBP2-72770AF532 0.1 mL

Mouse Monoclonal MOX1 Antibody (OTI5B11) [Alexa Fluor 532]

Sign In for Pricing
View Details
Snx31 ORF Vector (Mouse) (pORF)
ORF058132 1.0 µg DNA

Snx31 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details