Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC8 (NM_000082) Human Over-expression Lysate
LS001161-100ug 100 µg

ERCC8 (NM_000082) Human Over-expression Lysate

Sign In for Pricing
View Details
TCP10L3 (NM_004610) Human Over-expression Lysate
LS006953-100ug 100 µg

TCP10L3 (NM_004610) Human Over-expression Lysate

Sign In for Pricing
View Details
Bovine Glutamate Receptor, Ionotropic, N-Methyl-D-Aspartate 2B ELISA Kit
OM617835 96 Strip Well

Bovine Glutamate Receptor, Ionotropic, N-Methyl-D-Aspartate 2B ELISA Kit

Sign In for Pricing
View Details
HRASLS2 Antibody
A46938-50UL 50 μL

HRASLS2 Antibody

Sign In for Pricing
View Details
Rabbit anti-human Ryanodine receptor 1 polyclonal Antibody, Biotin conjugated
MBS1490203-01 0.05 mg

Rabbit anti-human Ryanodine receptor 1 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Ryanodine receptor 1 polyclonal Antibody, Biotin conjugated
MBS1490203-02 0.1 mg

Rabbit anti-human Ryanodine receptor 1 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details