Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPFF, CT (NPFF, FMRFamide-related peptides, Neuropeptide SF, Neuropeptide FF, Neuropeptide AF) (PE)
MBS6326225-01 0.2 mL

NPFF, CT (NPFF, FMRFamide-related peptides, Neuropeptide SF, Neuropeptide FF, Neuropeptide AF) (PE)

Sign In for Pricing
View Details
NPFF, CT (NPFF, FMRFamide-related peptides, Neuropeptide SF, Neuropeptide FF, Neuropeptide AF) (PE)
MBS6326225-02 5x 0.2 mL

NPFF, CT (NPFF, FMRFamide-related peptides, Neuropeptide SF, Neuropeptide FF, Neuropeptide AF) (PE)

Sign In for Pricing
View Details
Epac Polyclonal Antibody
ABP53470-01 30 µL

Epac Polyclonal Antibody

Sign In for Pricing
View Details
Epac Polyclonal Antibody
ABP53470-02 100 µL

Epac Polyclonal Antibody

Sign In for Pricing
View Details
Epac Polyclonal Antibody
ABP53470-03 200 µL

Epac Polyclonal Antibody

Sign In for Pricing
View Details
Neuropilin-1 (CD304)
299197 50 µg

Neuropilin-1 (CD304)

Sign In for Pricing
View Details