Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAEP Antibody
ABD2701 100 µg

PAEP Antibody

Sign In for Pricing
View Details
1700011L22Rik Protein Vector (Mouse) (pPB-N-His)
PV146835 500 ng

1700011L22Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CLEC17A Protein Vector (Human) (pPM-C-HA)
PV069815 500 ng

CLEC17A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Olr1111 Rat shRNA Plasmid (Locus ID 300205)
TL700163 1 Kit

Olr1111 Rat shRNA Plasmid (Locus ID 300205)

Sign In for Pricing
View Details
Angptl8 (NM_001271710) Rat Tagged ORF Clone
RR216014 10 µg

Angptl8 (NM_001271710) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Acetic acid, 2-[2-[2-[[4- (11,12-didehydrodibenz[b, f]azocin-5 (6H) -yl) -1,4-dioxobutyl]amino]ethoxy]ethoxy]-
JH917383 1 Each

Acetic acid, 2-[2-[2-[[4- (11,12-didehydrodibenz[b, f]azocin-5 (6H) -yl) -1,4-dioxobutyl]amino]ethoxy]ethoxy]-

Sign In for Pricing
View Details