Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Azido-peg6-t-butyl ester
abx180686-01 100 mg

Azido-peg6-t-butyl ester

Sign In for Pricing
View Details
Azido-peg6-t-butyl ester
abx180686-02 500 mg

Azido-peg6-t-butyl ester

Sign In for Pricing
View Details
Azido-peg6-t-butyl ester
abx180686-03 1 g

Azido-peg6-t-butyl ester

Sign In for Pricing
View Details
Gap junction alpha-3 protein (GJA3) Human ELISA Kit
D6193 96 Tests

Gap junction alpha-3 protein (GJA3) Human ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-IQGAP2 antibody
SL7176R-01 50 µL

Rabbit Anti-IQGAP2 antibody

Sign In for Pricing
View Details
Rabbit Anti-IQGAP2 antibody
SL7176R-02 100 µL

Rabbit Anti-IQGAP2 antibody

Sign In for Pricing
View Details