Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ING4 (NM_001127582) Human 3' UTR Clone
SC208706 10 µg

ING4 (NM_001127582) Human 3' UTR Clone

Sign In for Pricing
View Details
Olfr723 (NM_001011530) Mouse Untagged Clone
MC214238 10 µg

Olfr723 (NM_001011530) Mouse Untagged Clone

Sign In for Pricing
View Details
Amphetamine test in urine
C8401 150 Tests

Amphetamine test in urine

Sign In for Pricing
View Details
Pigeon Serine/Threonine-Protein Kinase Haspin (GSG2) ELISA Kit
MBS9359525 Inquire

Pigeon Serine/Threonine-Protein Kinase Haspin (GSG2) ELISA Kit

Sign In for Pricing
View Details
Pribolab® High Speed Homogenizer
HWEQ-HG 4020S 1 Unit

Pribolab® High Speed Homogenizer

Sign In for Pricing
View Details
Fish FSH ELISA kit
QY-E160041 96 Tests

Fish FSH ELISA kit

Sign In for Pricing
View Details