FGF-19, Human (HEK293, Flag)
FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.
Product Specifications
Product Name Alternative
FGF-19 Protein, Human (HEK293, Flag), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html
Purity
95.88
Smiles
RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Molecular Formula
9965 (Gene_ID) O95750 (L25-K216) (Accession)
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV650987 1.0 µg DNA
EDEM2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details 
GTR15113715 1 Vial
Lentiviral human WDR62 shRNA (UAS) - Lentiviral human WDR62 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
MBS1277975-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock
B3GNT5 cDNA Clone
Sign In for Pricing
View Details 
MBS1277975-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock
B3GNT5 cDNA Clone
Sign In for Pricing
View Details TL703630V 500 µL Each
Tor1b Rat shRNA Lentiviral Particle (Locus ID 311854)
Sign In for Pricing
View Details