Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCI-H1975-EGFR-V774-C775insHV Overexpressing Cell Line
RG-1458 5x 10^6

NCI-H1975-EGFR-V774-C775insHV Overexpressing Cell Line

Sign In for Pricing
View Details
TMC4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2383308 1.0 µg DNA

TMC4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal Septin-9 Antibody
NBP3-29338 10 µg

Rabbit Polyclonal Septin-9 Antibody

Sign In for Pricing
View Details
1- (3,4-Dihydroxyphenyl) -7- (4-hydroxyphenyl) hept-6-en-3-ol
MF-0046536 5 mg

1- (3,4-Dihydroxyphenyl) -7- (4-hydroxyphenyl) hept-6-en-3-ol

Sign In for Pricing
View Details
B-30 Block
AS-01031-02 1 Unit

B-30 Block

Sign In for Pricing
View Details
Rabbit Polyclonal CTRP6 Antibody [DyLight 550]
NBP2-99566R 0.1 mL

Rabbit Polyclonal CTRP6 Antibody [DyLight 550]

Sign In for Pricing
View Details