Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5M10 Human Gene Knockout Kit (CRISPR)
KN414430 1 Kit

OR5M10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Blood vessel, Vein (Frozen)
MBS639955-01 5 Sections

Tissue, Section, Human Adult Normal, Blood vessel, Vein (Frozen)

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Blood vessel, Vein (Frozen)
MBS639955-02 5x 5 Sections

Tissue, Section, Human Adult Normal, Blood vessel, Vein (Frozen)

Sign In for Pricing
View Details
Human Tetraspanin 30Cluster of Differentiation 63, CD63 ELISA Kit
MBS1608892-01 48 Well

Human Tetraspanin 30Cluster of Differentiation 63, CD63 ELISA Kit

Sign In for Pricing
View Details
Human Tetraspanin 30Cluster of Differentiation 63, CD63 ELISA Kit
MBS1608892-02 96 Well

Human Tetraspanin 30Cluster of Differentiation 63, CD63 ELISA Kit

Sign In for Pricing
View Details
Human Tetraspanin 30Cluster of Differentiation 63, CD63 ELISA Kit
MBS1608892-03 5x 96 Well

Human Tetraspanin 30Cluster of Differentiation 63, CD63 ELISA Kit

Sign In for Pricing
View Details