FGF-19, Human (HEK293, Flag)
FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.
Product Specifications
Product Name Alternative
FGF-19 Protein, Human (HEK293, Flag), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html
Purity
95.88
Smiles
RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Molecular Formula
9965 (Gene_ID) O95750 (L25-K216) (Accession)
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2082817-01 0.1 mL
APC-Linked Polyclonal Antibody to CASP2 And RIPK1 Domain Containing Adaptor With Death Domain Protein (CRADD)
Sign In for Pricing
View Details 
MBS2082817-02 0.2 mL
APC-Linked Polyclonal Antibody to CASP2 And RIPK1 Domain Containing Adaptor With Death Domain Protein (CRADD)
Sign In for Pricing
View Details MBS2082817-03 0.5 mL
APC-Linked Polyclonal Antibody to CASP2 And RIPK1 Domain Containing Adaptor With Death Domain Protein (CRADD)
Sign In for Pricing
View Details 
MBS2082817-04 1 mL
APC-Linked Polyclonal Antibody to CASP2 And RIPK1 Domain Containing Adaptor With Death Domain Protein (CRADD)
Sign In for Pricing
View Details 
MBS2082817-05 5 mL
APC-Linked Polyclonal Antibody to CASP2 And RIPK1 Domain Containing Adaptor With Death Domain Protein (CRADD)
Sign In for Pricing
View Details MBS2082817-06 5x 5 mL
APC-Linked Polyclonal Antibody to CASP2 And RIPK1 Domain Containing Adaptor With Death Domain Protein (CRADD)
Sign In for Pricing
View Details