Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIC-A (Trimeric Intracellular Cation Channel Type A, TRICA, Transmembrane Protein 38A, TMEM38A, 27kD Sarcoplasmic Reticulum Protein, Mitsugumin-33A, SPR-27)

MBS6000958-01 0.1 mg

TRIC-A (Trimeric Intracellular Cation Channel Type A, TRICA, Transmembrane Protein 38A, TMEM38A, 27kD Sarcoplasmic Reticulum Protein, Mitsugumin-33A, SPR-27)

Sign In for Pricing

TRIC-A (Trimeric Intracellular Cation Channel Type A, TRICA, Transmembrane Protein 38A, TMEM38A, 27kD Sarcoplasmic Reticulum Protein, Mitsugumin-33A, SPR-27)

MBS6000958-02 5x 0.1 mg

TRIC-A (Trimeric Intracellular Cation Channel Type A, TRICA, Transmembrane Protein 38A, TMEM38A, 27kD Sarcoplasmic Reticulum Protein, Mitsugumin-33A, SPR-27)

Sign In for Pricing

NFKB1 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 1, Nuclear Factor NF-kappa-B p50 Subunit, DKFZp686C01211, MGC54151) (HRP)

MBS6386967-01 0.1 mL

NFKB1 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 1, Nuclear Factor NF-kappa-B p50 Subunit, DKFZp686C01211, MGC54151) (HRP)

Sign In for Pricing

NFKB1 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 1, Nuclear Factor NF-kappa-B p50 Subunit, DKFZp686C01211, MGC54151) (HRP)

MBS6386967-02 5x 0.1 mL

NFKB1 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 1, Nuclear Factor NF-kappa-B p50 Subunit, DKFZp686C01211, MGC54151) (HRP)

Sign In for Pricing

Monoclonal Antibody to Lipolysis Stimulated Lipoprotein Receptor (LSR)

MBS2139253-01 0.1 mL

Monoclonal Antibody to Lipolysis Stimulated Lipoprotein Receptor (LSR)

Sign In for Pricing

Monoclonal Antibody to Lipolysis Stimulated Lipoprotein Receptor (LSR)

MBS2139253-02 0.2 mL

Monoclonal Antibody to Lipolysis Stimulated Lipoprotein Receptor (LSR)

Sign In for Pricing