Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human (HEK293, Flag)

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human (HEK293, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human-tag-free.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (L25-K216) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sst (NM_009215) Mouse Tagged ORF Clone
MR200492 10 µg

Sst (NM_009215) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rat Monoclonal DPP3 Antibody (986613) [DyLight 680]
MAB8087FR 0.1 mL

Rat Monoclonal DPP3 Antibody (986613) [DyLight 680]

Sign In for Pricing
View Details
Human N-terminal extein, Ext-N ELISA Kit
SL1285Hu-01 48 Tests

Human N-terminal extein, Ext-N ELISA Kit

Sign In for Pricing
View Details
Human N-terminal extein, Ext-N ELISA Kit
SL1285Hu-02 96 Tests

Human N-terminal extein, Ext-N ELISA Kit

Sign In for Pricing
View Details
Rnf112 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3916903 1.0 µg DNA

Rnf112 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human IRAK1BP1 knockout cell line
ABC-KH7461 1 Vial

Human IRAK1BP1 knockout cell line

Sign In for Pricing
View Details