PDRG1, Human (His)
As a component of the PAQosome complex, the PDRG1 protein may play a role in chaperone-mediated protein folding. PAQosome is composed of multiple protein complexes, including PDRG1, and coordinates the biogenesis of multiple protein complexes. PDRG1 Protein, Human (His) is the recombinant human-derived PDRG1 protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
PDRG1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdrg1-protein-human-his.html
Purity
93.0
Smiles
MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG
Molecular Formula
81572 (Gene_ID) Q9NUG6 (M1-G133) (Accession)
Molecular Weight
Approximately 12 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Human epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit
Human epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit
Human epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit
Human epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit
Human epidermal growth factor receptor 2 (sp185/HER2) ELISA Kit