Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kielin/chordin-like protein (KCP), partial

Product Specifications

Product Name Alternative

Cysteine-rich BMP regulator 2 Cysteine-rich motor neuron 2 protein Kielin/chordin-like protein 1

Abbreviation

Recombinant Human KCP protein, partial

Gene Name

KCP

UniProt

Q6ZWJ8

Expression Region

1149-1543aa

Organism

Homo sapiens (Human)

Target Sequence

QSCVHQGREVASGERWTVDTCTSCSCMAGTVRCQSQRCSPLSCGPDKAPALSPGSCCPRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHSGDFSVHVTNDDRGRSGVAWTQEVAVLLGDMAVRLLQDGAVTVDGHPVALPFLQEPLLYVELRGHTVILHAQPGLQVLWDGQSQVEVSVPGSYQGRTCGLCGNFNGFAQDDLQGPEGLLLPSEAAFGNSWQVSEGLWPGRPCSAGREVDPCRAAGYRARREANARCGVLKSSPFSRCHAVVPPEPFFAACVYDLCACGPGSSADACLCDALEAYASHCRQAGVTPTWRGPTLCVVGCPLERGFVFDECGPPCPRTCFNQHIPLGELAAHCVRPCVPGCQCPAGLVEHEAHCIPPEAC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF594 conjugate, 0.1mg/mL
BNC941784-100 1x 100 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF568 conjugate, 0.1mg/mL
BNC680764-100 1x 100 µL

CD79a (IGA/764), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF568 conjugate, 0.1mg/mL
BNC680999-500 1x 500 µL

Cytokeratin, pan (Cocktail PAN-CK), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details