CCL6, Mouse
CCL6 Protein, Mouse is a CC chemokine found only in rodents and is associated with macrophage infiltration in chronic inflammation as well as a role in tumorigenesis. CCL6 Protein, Mouse is a recombinant mouse CCL6 (G22-A116) expressed by E. coli[1].
Product Specifications
Product Name Alternative
CCL6 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ccl6-protein-mouse.html
Purity
98.0
Smiles
GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
Molecular Formula
20305 (Gene_ID) P27784 (G22-A116) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Bing Ma, et al. The C10/CCL6 chemokine and CCR1 play critical roles in the pathogenesis of IL-13-induced inflammation and remodeling. J Immunol. 2004 Feb 1;172 (3) :1872-81.|[2]Andrew M LaFleur, et al. Role of CC chemokine CCL6/C10 as a monocyte chemoattractant in a murine acute peritonitis. Mediators Inflamm. 2004 Dec;13 (5-6) :349-55.|[3]Venkatesh Krishnan, et al. Omental macrophages secrete chemokine ligands that promote ovarian cancer colonization of the omentum via CCR1. Commun Biol. 2020 Sep 22;3 (1) :524.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
YVV33001 100 μg
Recombinant JCV Capsid protein VP1 Protein, N-GST & C-His
Sign In for Pricing
View Details AZQ7SXM7-PE 100 µg/Vial
Anti-Zebrafish PRPF31 Antibody Picoband® PE Conjugated
Sign In for Pricing
View Details 
CSB-MP017854HU (F2)-01 20 µg
Recombinant Human Placenta growth factor (PGF)
Sign In for Pricing
View Details CSB-MP017854HU (F2)-02 100 µg
Recombinant Human Placenta growth factor (PGF)
Sign In for Pricing
View Details CSB-MP017854HU (F2)-03 1 mg
Recombinant Human Placenta growth factor (PGF)
Sign In for Pricing
View Details