Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL6, Mouse

CCL6 Protein, Mouse is a CC chemokine found only in rodents and is associated with macrophage infiltration in chronic inflammation as well as a role in tumorigenesis. CCL6 Protein, Mouse is a recombinant mouse CCL6 (G22-A116) expressed by E. coli[1].

Product Specifications

Product Name Alternative

CCL6 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl6-protein-mouse.html

Purity

98.0

Smiles

GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

Molecular Formula

20305 (Gene_ID) P27784 (G22-A116) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Bing Ma, et al. The C10/CCL6 chemokine and CCR1 play critical roles in the pathogenesis of IL-13-induced inflammation and remodeling. J Immunol. 2004 Feb 1;172 (3) :1872-81.|[2]Andrew M LaFleur, et al. Role of CC chemokine CCL6/C10 as a monocyte chemoattractant in a murine acute peritonitis. Mediators Inflamm. 2004 Dec;13 (5-6) :349-55.|[3]Venkatesh Krishnan, et al. Omental macrophages secrete chemokine ligands that promote ovarian cancer colonization of the omentum via CCR1. Commun Biol. 2020 Sep 22;3 (1) :524.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OR4C6 sgRNA gene knockout kit - Lentiviral human OR4C6 sgRNA gene knockout kit (plasmid)
GTR15362843 1 Vial

Lentiviral human OR4C6 sgRNA gene knockout kit - Lentiviral human OR4C6 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Bestatin
1733-500 500 mg

Bestatin

Sign In for Pricing
View Details
Anti-Aquaporin 9 Antibody
CQA3507-01 30 µL

Anti-Aquaporin 9 Antibody

Sign In for Pricing
View Details
Anti-Aquaporin 9 Antibody
CQA3507-02 50 μL

Anti-Aquaporin 9 Antibody

Sign In for Pricing
View Details
Anti-Aquaporin 9 Antibody
CQA3507-03 100 µL

Anti-Aquaporin 9 Antibody

Sign In for Pricing
View Details
Anti-Aquaporin 9 Antibody
CQA3507-04 200 µL

Anti-Aquaporin 9 Antibody

Sign In for Pricing
View Details