Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP1B2, Human (HEK293, His)

The ATP1B2 protein is the non-catalytic component of ATP hydrolase and promotes Na (+) /K (+) ion exchange across the plasma membrane. Its role is critical in mediating cell adhesion of neurons and astrocytes, promoting sticky cell interactions. ATP1B2 Protein, Human (HEK293, His) is the recombinant human-derived ATP1B2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ATP1B2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp1b2-protein-human-hek293-his.html

Purity

98.0

Smiles

DHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

Molecular Formula

482 (Gene_ID) P14415 (D68-T290) (Accession)

Molecular Weight

Approximately 40-60 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium, enzymatic
910110 5x 10 mL (50 mL)

Potassium, enzymatic

Sign In for Pricing
View Details
Quick Step Human Cathepsin K, cath-K ELISA Kit
QS0426Hu-01 48 Tests

Quick Step Human Cathepsin K, cath-K ELISA Kit

Sign In for Pricing
View Details
Quick Step Human Cathepsin K, cath-K ELISA Kit
QS0426Hu-02 96 Tests

Quick Step Human Cathepsin K, cath-K ELISA Kit

Sign In for Pricing
View Details
UQCRC1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
49233156 3x 1.0 µg DNA

UQCRC1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
NXF3 Blocking Peptide
MBS8243566-01 1 mg

NXF3 Blocking Peptide

Sign In for Pricing
View Details
NXF3 Blocking Peptide
MBS8243566-02 5 mg

NXF3 Blocking Peptide

Sign In for Pricing
View Details