Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-9 Protein, Mouse (sf9, His)

IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.IL-9 Protein, Mouse (sf9, His) is the recombinant mouse-derived IL-9 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-9 Protein, Mouse (sf9, His), Mouse, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-9-protein-mouse-sf9-his.html

Purity

97.30

Smiles

MLVTYILASVLLFSSVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

Molecular Formula

16198 (Gene_ID) P15247 (Q19-P144) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human GEM shRNA (UAS) - Lentiviral human GEM shRNA (UAS) (100)
GTR15094398 1 Vial

Lentiviral human GEM shRNA (UAS) - Lentiviral human GEM shRNA (UAS) (100)

Ask
View Details
BCA3, NT (AKIP1, BCA3, C11orf17, A-kinase-interacting protein 1, Breast cancer-associated gene 3 protein, PKA-interacting protein, Proline-rich protein BCA3) (Biotin) discontinued
032441-Biotin 200 µL

BCA3, NT (AKIP1, BCA3, C11orf17, A-kinase-interacting protein 1, Breast cancer-associated gene 3 protein, PKA-interacting protein, Proline-rich protein BCA3) (Biotin) discontinued

Ask
View Details
Research Grade Melrilimab
MBS1563766-01 0.1 mg

Research Grade Melrilimab

Ask
View Details
Research Grade Melrilimab
MBS1563766-02 1 mg

Research Grade Melrilimab

Ask
View Details
Research Grade Melrilimab
MBS1563766-03 5x 1 mg

Research Grade Melrilimab

Ask
View Details
Recombinant Human HER3 (C-mFc)
32-11113-10 10 µg

Recombinant Human HER3 (C-mFc)

Ask
View Details