IL-9 Protein, Mouse (sf9, His)
IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.IL-9 Protein, Mouse (sf9, His) is the recombinant mouse-derived IL-9 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Product Specifications
Product Name Alternative
IL-9 Protein, Mouse (sf9, His), Mouse, Sf9 insect cells
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-9-protein-mouse-sf9-his.html
Purity
97.30
Smiles
MLVTYILASVLLFSSVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
Molecular Formula
16198 (Gene_ID) P15247 (Q19-P144) (Accession)
Molecular Weight
Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Mouse Monoclonal CLEC14A Antibody (743940) [DyLight 650]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
CD47 (Antigenic Surface determinant Protein OA3, CD 47, CD47 Antigen, CD47 Glycoprotein, CD47 Molecule, CD47, IAP, IAP, Integrin Associated Protein, Integrin Associated Signal Transducer, Integrin-Associated Protein, Leukocyte Surface Antigen CD47, MER 6, MER6, OA 3, OA3, Protein MER6, Rh Related Antigen) discontinued
CD47 (Antigenic Surface determinant Protein OA3, CD 47, CD47 Antigen, CD47 Glycoprotein, CD47 Molecule, CD47, IAP, IAP, Integrin Associated Protein, Integrin Associated Signal Transducer, Integrin-Associated Protein, Leukocyte Surface Antigen CD47, MER 6, MER6, OA 3, OA3, Protein MER6, Rh Related Antigen) discontinued