IL-9 Protein, Mouse (sf9, His)
IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.IL-9 Protein, Mouse (sf9, His) is the recombinant mouse-derived IL-9 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Product Specifications
Product Name Alternative
IL-9 Protein, Mouse (sf9, His), Mouse, Sf9 insect cells
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-9-protein-mouse-sf9-his.html
Purity
97.30
Smiles
MLVTYILASVLLFSSVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
Molecular Formula
16198 (Gene_ID) P15247 (Q19-P144) (Accession)
Molecular Weight
Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
DEN1A, CT (DENND1A, FAM31A, KIAA1608, DENN domain-containing protein 1A, Connecdenn 1, Protein FAM31A) (Biotin)
DEN1A, CT (DENND1A, FAM31A, KIAA1608, DENN domain-containing protein 1A, Connecdenn 1, Protein FAM31A) (Biotin)
