Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRACC/SLAMF7, Human (HEK293, His)

The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that complexly regulates immune cell activation and differentiation through finely regulated interactions. Isoform 1 mediates NK cell activation through an SH2D1A-independent ERK-mediated pathway and positively regulates NK cell function dependent on phosphorylated SH2D1B. CRACC/SLAMF7 Protein, Human (HEK293, His) is the recombinant human-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRACC/SLAMF7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cracc-slamf7-protein-human-hek-293-his.html

Purity

98.0

Smiles

SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM

Molecular Formula

57823 (Gene_ID) Q9NQ25-1 (S23-M226) (Accession)

Molecular Weight

35-44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAFAH1B3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A9]
TA804470AM 100 µL

PAFAH1B3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A9]

Sign In for Pricing
View Details
Canine Wiskott Aldrich Syndrome Protein Family, Member 2 ELISA Kit
MBS094959-01 48 Well

Canine Wiskott Aldrich Syndrome Protein Family, Member 2 ELISA Kit

Sign In for Pricing
View Details
Canine Wiskott Aldrich Syndrome Protein Family, Member 2 ELISA Kit
MBS094959-02 96 Well

Canine Wiskott Aldrich Syndrome Protein Family, Member 2 ELISA Kit

Sign In for Pricing
View Details
Canine Wiskott Aldrich Syndrome Protein Family, Member 2 ELISA Kit
MBS094959-03 5x 96 Well

Canine Wiskott Aldrich Syndrome Protein Family, Member 2 ELISA Kit

Sign In for Pricing
View Details
Canine Wiskott Aldrich Syndrome Protein Family, Member 2 ELISA Kit
MBS094959-04 10x 96 Well

Canine Wiskott Aldrich Syndrome Protein Family, Member 2 ELISA Kit

Sign In for Pricing
View Details
Fam13b sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4539404 1.0 µg DNA

Fam13b sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details