Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cardiac phospholamban/PLN, Human (P.pastoris, GST)

Cardiac phospholamban (PLN) strictly regulates ATP2A2 in the cardiac sarcoplasmic reticulum, reversibly inhibits ATPase activity and affects myocardial contractility. Modulation of PLN reduces the affinity of ATPase for Ca (2+), thereby affecting calcium reuptake during muscle relaxation and maintaining cardiac calcium homeostasis. Cardiac phospholamban/PLN, Human (P.pastoris, GST) is the recombinant human-derived Cardiac phospholamban/PLN, expressed by P. pastoris , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Cardiac phospholamban/PLN, Human (P.pastoris, GST), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cardiac-phospholamban-pln-human-p-pastoris-gst.html

Purity

97.00

Smiles

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Molecular Formula

5350 (Gene_ID) P26678 (M1-L52) (Accession)

Molecular Weight

Approximately 33.1kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3, phosphorylated (Ser10) (H3F3A, H3F3B) (Azide free) (HRP) discontinued
H5110-13B3-HRP 200 µL

Histone H3, phosphorylated (Ser10) (H3F3A, H3F3B) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Lentiviral human CLIP1 shRNA (UAS) - Lentiviral human CLIP1 shRNA (UAS, GFP) (25)
GTR15324023 1 Vial

Lentiviral human CLIP1 shRNA (UAS) - Lentiviral human CLIP1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Human GNAO1 Protein, N-His
orb3058790-01 50 µg

Recombinant Human GNAO1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GNAO1 Protein, N-His
orb3058790-02 100 µg

Recombinant Human GNAO1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GNAO1 Protein, N-His
orb3058790-03 1 mg

Recombinant Human GNAO1 Protein, N-His

Sign In for Pricing
View Details
Lentiviral human POLR3B shRNA (UAS) - Lentiviral human POLR3B shRNA (UAS, RFP) (100)
GTR15329751 1 Vial

Lentiviral human POLR3B shRNA (UAS) - Lentiviral human POLR3B shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details