Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAP-2/CXCL7, Human (HEK293, His)

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. NAP-2/CXCL7 Protein, Human (HEK 293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 94 amino acids (S35-D128) .

Product Specifications

Product Name Alternative

NAP-2/CXCL7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nap-2-cxcl7-protein-human-hek-293-his.html

Purity

98.0

Smiles

SSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Molecular Formula

5473 (Gene_ID) P02775 (S35-D128) (Accession)

Molecular Weight

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Qian Guo, et al. CXCL7 promotes proliferation and invasion of cholangiocarcinoma cells. Oncol Rep. 2017 Feb;37 (2) :1114-1122.|[2]Yu-Shan Wang, et al. Canine CXCL7 and its functional expression in dendritic cells undergoing maturation. Vet Immunol Immunopathol. 2010 May 15;135 (1-2) :128-136.|[3]Laurens Kruidenier, et al. Myofibroblast matrix metalloproteinases activate the neutrophil chemoattractant CXCL7 from intestinal epithelial cells. Gastroenterology. 2006 Jan;130 (1) :127-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mb21d2 activation kit by CRISPRa
GA214879 1 Kit

Mouse Mb21d2 activation kit by CRISPRa

Sign In for Pricing
View Details
MIB2 Polyclonal Antibody
JOT-AP11327-01 20 µL

MIB2 Polyclonal Antibody

Sign In for Pricing
View Details
MIB2 Polyclonal Antibody
JOT-AP11327-02 50 μL

MIB2 Polyclonal Antibody

Sign In for Pricing
View Details
MIB2 Polyclonal Antibody
JOT-AP11327-03 100 µL

MIB2 Polyclonal Antibody

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2423), CF594 conjugate, 0.1mg/mL
BNC942423-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2423), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
InVivoMAb Anti-Rotavirus A/RV-A Intermediate capsid protein VP6 (Iv0012)
MBS1570074-01 0.1 mg

InVivoMAb Anti-Rotavirus A/RV-A Intermediate capsid protein VP6 (Iv0012)

Sign In for Pricing
View Details