Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Trefoil factor 3 (TFF3)

Product Specifications

Product Name Alternative

(Intestinal trefoil factor)

Abbreviation

Recombinant Dog TFF3 protein

Gene Name

TFF3

UniProt

Q863B4

Expression Region

24-80aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

YQGLATNLCEVPPKDRVDCGYPEITSEQCVNRGCCFDSSIHGVPWCFKPLQDTECRF

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

7.4 kDa

References & Citations

"Canine trefoil factor 3 (TFF3) mRNA from colonic mucosa." Campbell B.G., Jabbes M. Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tpd52l2 Mouse Gene Knockout Kit (CRISPR)
KN518084 1 Kit

Tpd52l2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RASGRP2 (NM_001098670) Human Over-expression Lysate
LY420662 100 µg

RASGRP2 (NM_001098670) Human Over-expression Lysate

Sign In for Pricing
View Details
IL-10R1, Mouse (Interleukin-10 Receptor 1) (CD210) (1B1.3a), CF647 conjugate, 0.1mg/mL
BNC472001-100 1x 100 µL

IL-10R1, Mouse (Interleukin-10 Receptor 1) (CD210) (1B1.3a), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTC24 Human Gene Knockout Kit (CRISPR)
KN425421 1 Kit

TTC24 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS633511 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
MAGEA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E11]
TA800918AM 100 µL

MAGEA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E11]

Sign In for Pricing
View Details